KEGG   Croceibacter atlanticus: CA2559_13508Help
Entry
CA2559_13508      CDS       T01256                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cat  Croceibacter atlanticus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cat00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2922376..2923227
Genome map
AA seq 283 aa AA seqDB search
MAFSNTSSLTINCNGSLIDLKSPKVMGILNVTPDSFYDGGTYSKLSDVLKHVEHMLTNGA
TFIDVGAYSSRPNADDVSETEELERSVPVIEAISKTFPEALISIDTFRSSIAKACVNAGA
SLVNDISAGQLDKEMMPTVATLQVPYIMMHMKGTPQTMTSNTNYDNLTKDILFYFSEKIS
EANTLGINDIILDVGFGFSKTREQNFELLDHLDSFNITGLPMLVGLSRKSTIYKTLNTTA
SKALNGTTAMHAWALQQGSNILRVHDVKEAMEVITLYNALKSN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagcaacacctcatctttaactataaattgcaacggttctttaatagattta
aagtcacctaaagtgatgggaattttaaatgtgacaccagattctttttacgatggcggt
acctattcaaaactatctgatgttttaaaacatgttgaacatatgcttacaaatggcgca
acatttattgatgttggtgcttacagcagtagaccaaacgcagatgatgtttctgaaacg
gaagaactagagcgaagtgtcccagtaatcgaagctattagtaaaacatttcctgaagct
cttatatctatagatacttttagaagctctatagcaaaagcttgtgtaaacgctggcgcc
agtctcgtaaatgatatttctgcaggacaattagacaaagagatgatgccaacagttgct
acattgcaagttccttatattatgatgcatatgaaaggtactccgcaaacaatgacaagt
aacactaattatgacaatcttactaaagatattcttttctatttttctgaaaaaatttct
gaagcaaacactttaggaataaatgatatcatcttagatgtaggttttggcttctctaaa
acacgtgaacaaaattttgagcttttagaccatctagatagttttaatattactggattg
ccaatgttagtagggctttcaagaaaatctactatttacaaaaccttaaacactacagca
tcaaaagctttaaatggcactacagctatgcacgcttgggcattacaacaaggcagtaat
atcttacgtgttcatgatgttaaagaagctatggaagtgataacactttataatgcgctt
aaaagcaattaa

DBGET integrated database retrieval system