KEGG   Croceibacter atlanticus: CA2559_13508Help
Entry
CA2559_13508      CDS       T01256                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cat  Croceibacter atlanticus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CA2559_13508
Enzymes [BR:cat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CA2559_13508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2922376..2923227
Genome map
AA seq 283 aa AA seqDB search
MAFSNTSSLTINCNGSLIDLKSPKVMGILNVTPDSFYDGGTYSKLSDVLKHVEHMLTNGA
TFIDVGAYSSRPNADDVSETEELERSVPVIEAISKTFPEALISIDTFRSSIAKACVNAGA
SLVNDISAGQLDKEMMPTVATLQVPYIMMHMKGTPQTMTSNTNYDNLTKDILFYFSEKIS
EANTLGINDIILDVGFGFSKTREQNFELLDHLDSFNITGLPMLVGLSRKSTIYKTLNTTA
SKALNGTTAMHAWALQQGSNILRVHDVKEAMEVITLYNALKSN
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggcatttagcaacacctcatctttaactataaattgcaacggttctttaatagattta
aagtcacctaaagtgatgggaattttaaatgtgacaccagattctttttacgatggcggt
acctattcaaaactatctgatgttttaaaacatgttgaacatatgcttacaaatggcgca
acatttattgatgttggtgcttacagcagtagaccaaacgcagatgatgtttctgaaacg
gaagaactagagcgaagtgtcccagtaatcgaagctattagtaaaacatttcctgaagct
cttatatctatagatacttttagaagctctatagcaaaagcttgtgtaaacgctggcgcc
agtctcgtaaatgatatttctgcaggacaattagacaaagagatgatgccaacagttgct
acattgcaagttccttatattatgatgcatatgaaaggtactccgcaaacaatgacaagt
aacactaattatgacaatcttactaaagatattcttttctatttttctgaaaaaatttct
gaagcaaacactttaggaataaatgatatcatcttagatgtaggttttggcttctctaaa
acacgtgaacaaaattttgagcttttagaccatctagatagttttaatattactggattg
ccaatgttagtagggctttcaagaaaatctactatttacaaaaccttaaacactacagca
tcaaaagctttaaatggcactacagctatgcacgcttgggcattacaacaaggcagtaat
atcttacgtgttcatgatgttaaagaagctatggaagtgataacactttataatgcgctt
aaaagcaattaa

DBGET integrated database retrieval system