KEGG   Chloroflexus aurantiacus: Caur_0645Help
Entry
Caur_0645         CDS       T00639                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cau  Chloroflexus aurantiacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_0645
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Caur_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
866452..867876
Genome map
AA seq 474 aa AA seqDB search
MMAGYDSVVIGGGIAGLAAAYTLHKRGYRVLVIESTNRVGGVIQTITTPEGYILDCGPNT
VGTGDARLWQELIDLGLRERITPAAPCSKRRFILINGTPVEIPTSPVGLITTRLLSWRGK
LRVLAEPFINRGSTDPDESVAAFFTRRIGAEATAHLLDPFVAGVYAGDPQRLSTAAVFPS
LWEAAQRSGSIVRGMLSKPKPKTQVSEPKMRSRTFTFRGGLAEWPRALAQALGAGNVWTE
RRVVKLQPRDSWWEVTIDGVNGPETLISRSLIIATPAFTAADLIESVDQRAAGALRGIPY
APVAVVHLGFRRDQISQELSGFGVLAPSSEQRQFLGILWTSSIFPHVAPHDHVLTTTLSG
GAIRPELAERSDETLIEAAIRDHHQLLGIRGQPIFTHVTRWRTAIAQYTFGHRERIATLV
QLEQRLPTIQFAGSYRDGVGVPKTWASGVQAGERIAAALAAHGTTAVSTETASG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgggatacgacagtgtagtgattggcggtggcattgccggtttagctgcggct
tacacgctccacaagcgtggttatcgggtcctggtcatcgagtcgaccaatcgcgttggc
ggtgtgatccagaccatcaccacaccagaaggctacattctcgattgtgggccgaacacg
gtgggtaccggcgatgcgcgattgtggcaggaactgatcgatctgggtctgcgcgagcgg
atcacaccggcagcgccatgtagcaaacggcggttcatcctgatcaatggtacaccggtt
gaaatcccaacctcaccagtcgggctgattaccacgcgattactctcgtggcgggggaaa
ttgcgggtactggccgaaccgttcatcaaccgtggatcgaccgatcccgatgaaagcgtt
gctgccttcttcacccgccggattggtgcagaggctaccgcccacctcctcgatccattt
gttgccggcgtctacgctggcgatccgcaacggctctcgactgcggcagtctttccatca
ctgtgggaagcggcccagcgcagtggcagcatcgtgcgcggcatgctgagcaaacccaaa
ccgaagactcaggtgagtgagccaaagatgcgcagccgcacctttaccttccgcggtggc
ctggccgaatggccacgcgctctggcgcaagccctgggtgccggcaatgtctggacagaa
cggcgcgtggtcaagctccaaccacgcgactcctggtgggaagtgacgattgatggtgtg
aacggcccggagacactcatcagtcgcagcctcattatcgccaccccagcctttacggcg
gctgatctcattgagtcggttgatcaaagagcggctggtgccctacgcggcattccgtat
gcgccggtagcagtggtacatctcggctttcgtcgtgaccagatcagccaggaattgagc
ggctttggtgtgctggccccctcaagcgaacagcgtcagttcctcggcattctctggaca
tcaagcatcttcccgcacgttgcaccacacgatcatgtcctcaccacaaccctcagtggt
ggtgctatccggcccgaactggccgaacggagtgacgaaacactgattgaagcggccatt
cgcgatcatcaccagctcctggggatcagagggcaaccgatcttcacccatgttactcgc
tggcgaaccgccattgcccagtatacctttgggcaccgcgagcggattgccaccctcgtg
caactcgaacagcgcctgccgaccatccagtttgccggcagctaccgcgacggcgttgga
gtgcccaaaacctgggccagcggtgtgcaggcaggcgagcggatcgctgcggcactggca
gcccatggaactaccgcagtttccacagagacggcgtcggggtga

DBGET integrated database retrieval system