KEGG   Chloroflexus aurantiacus: Caur_0683Help
Entry
Caur_0683         CDS       T00639                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00260  Glycine, serine and threonine metabolism
cau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01130  Biosynthesis of antibiotics
cau01230  Biosynthesis of amino acids
Module
cau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caur_0683 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caur_0683 (trpA)
Enzymes [BR:cau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Caur_0683 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-GeneID: 5828134
NCBI-ProteinID: YP_001634312
UniProt: A9WFI5
Position
924513..925313
Genome map
AA seq 266 aa AA seqDB search
MSRIAETFARLRAAGRIALMPYLTVGFPERTSTLELVPALEAAGASLFELGIPFSDPLAD
GTTIQRATQRALENGITIADCIATVAELRARRVAAPLLLMGYYNPLLRYGLERACAALAA
AGGDGWIIPDLPLEEADDLRQLAAAHQLDLIMFIAPTTPPARISQITAQASGFLYIVSLT
GVTGARQTLAGNLTDLIANVRQQTNLPLVVGFGISQPAHIAEVARIADGAIVGSALIDRL
ERLPPEDRVSGAAAYIRELLSAVARP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaatagccgaaacatttgccagactccgcgctgcggggcgtattgcgctaatg
ccatacctgaccgtaggttttcccgaacgcaccagcacccttgaactggtaccggccctc
gaagcagccggcgccagtctgtttgaattgggcatccccttctccgatccgctggcagac
ggcacgaccattcagcgggcgacccagcgcgctctggaaaacgggattacgattgccgat
tgtattgcaacggtcgccgaattacgggcccgtcgggtggcggcccccctgctgttgatg
gggtactacaacccgttgctccgttacggtctcgaacgcgcctgtgccgctctggcggca
gccggtggcgatggctggattattcccgatctgccgctcgaagaagcagatgatctccgt
cagcttgccgctgctcaccagctcgacctgataatgttcatcgcccccaccaccccaccg
gcccggatcagccagatcactgcccaggccagtggctttctttacatcgtctcgctaacc
ggtgtgaccggtgcccggcagactttagccgggaatctgaccgatctgattgccaatgtg
cgccagcagacgaatctgccactggttgtcggttttgggatcagccagccagcgcatatt
gctgaagtagccaggattgccgatggagcaattgttggcagtgccttgattgatcgcctg
gaacgtctgccacctgaagaccgggtgagtggtgccgctgcgtatattcgcgaactgttg
agcgccgttgcacgaccgtaa

DBGET integrated database retrieval system