KEGG   Chloroflexus aurantiacus: Caur_0824Help
Entry
Caur_0824         CDS       T00639                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cau  Chloroflexus aurantiacus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1121541..1123718)
Genome map
AA seq 725 aa AA seqDB search
MQQLDGTLERITFQSESDGYTVAQLRPLGKRHTVTIVGNLPGVQPGEQLSLEGEWRDHPT
HGRQFHVQRYRSRLPATVDGIRRYLGSGLIKGVGPVLAKRITETFGKYTLEVLDREPERL
SEVPGLGRKKAVLIAEAWRAQQRIKDLMLLLQDLGLPTGVAVRIYRHYGDDALRVVQQEP
YRLADEVDGVGFRTADAIAAGLGIARDDPQRIAAGLRYTLAQASDEGHCYLPAGELTRRA
ASLLSVTTAAVTDVFTQMVATNQLWRDPIVADPDPDRYPIYLPPLAFAEIGVANAIRRLI
QQRSSLAARYAPSRWNLVFAHLAERRGINLSDQQRRAVQTALTTPVMLLTGGPGTGKTTS
LRALVMLLQARGYRPLLAAPTGRAARRLSEATGLEARTIHRLLEYGPDGTFRRNAEYPLD
CDLLVIDEASMLDIVLANQLLKAIPAGAHLVIVGDADQLPSVGPGRVLGDVIESGVVPRV
HLDAIFRQAAGSGIAANARRINEGHLPEWGAHDDFYFFAAATPERCAALTVELVVERIPR
RFGFDPRRDIQVLSPTHKGVAGVAALNAALQAALNPPRPGVAEYHSGATIFRVGDRVIQQ
RNDYDRDVYNGDVGEIVAVDPTGPTVMVRFEDGRTIRYNGLDLDDLTLAYALSVHKSQGS
EYPVVVLPLLLSHQPLLQRNLIYTAVTRARQLVVIVGDRRAVEVAIAAANVERRYTGLSI
RLGRT
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcttgacggcaccctcgaacggatcacctttcagagtgagagcgatggctac
accgtggcccaacttcgtccgcttggcaaacgtcacacggtgacaattgtcggcaacctg
ccgggcgtacagcccggtgaacaactcagtctcgaaggtgaatggcgcgatcacccgacc
catggccggcagtttcacgtccagcgctaccggagccgtctgccagccacggttgatggt
attcgccgctatctgggcagcggcttgatcaagggtgtcgggccggtcctcgccaaacgg
atcactgaaacctttggcaagtacaccttagaggtgctggatcgcgaaccggagcgtctg
agcgaagtccccggtctggggcggaagaaggccgtgctgatcgccgaggcatggcgggcg
cagcagcgtatcaaagacctgatgttactcctgcaggacctgggtctgcctaccggggtt
gccgttcgtatctaccggcattacggcgatgacgctttgcgagtggtgcaacaggaaccg
taccgtctggccgatgaagttgatggggttgggtttcgtaccgctgacgccattgccgcc
ggtctcggcattgcccgcgatgatccgcagcggatcgctgccgggctgcgttatacgctg
gcacaggcttccgacgaagggcattgttacctgcccgccggtgaactgaccagacgcgct
gccagcctgctttcagtgacgactgctgcggtgacggatgtgtttacgcagatggtggca
accaatcagctttggcgcgatccaattgtggccgatcccgaccctgatcgctacccgatc
tacctgccgccgctggcatttgccgagattggggttgccaacgccattcgccgcctgatc
cagcaacgctcgtccctggctgcacgctatgcacctagccgctggaacctggtgtttgcc
catcttgccgaacggcgtgggatcaatctcagcgatcaacagcgccgtgcggtacagacg
gcgctgaccacaccggtcatgttgctcaccggtgggccggggacgggcaaaaccaccagc
ctgcgtgcgctggtcatgcttttacaggccagaggctatcgtccgctgctggcggcaccg
accggacgggcagcccggcgcttgagcgaggcgaccggcctggaagcccgcactattcac
cgtctgcttgaatatggccctgatggaacatttcgccgcaacgccgaatatcccctcgac
tgtgacctcctggtgatcgatgaagccagtatgctcgatattgtgctggccaatcagctc
ctgaaggcgatcccagccggtgcgcatctggtcatcgtgggggatgccgatcaattgccg
agtgttggccctggccgtgtgcttggtgatgtgatcgagagtggggttgtgccgcgggtg
catctcgatgcgatctttcgccaggctgccggcagtgggattgccgccaatgcgcgacgg
atcaacgaaggccaccttcccgaatggggtgcgcacgatgatttctacttctttgcagct
gcaacacccgaacggtgtgcggcgctgaccgtagagctggtggtagaacgcatcccgcgt
cggtttggatttgatcctcgtcgtgatattcaggtgctcagtccaacccacaaaggggtg
gccggagttgcggccctcaatgcagcattgcaggcagcgttgaacccaccgcgccccggt
gtcgccgaataccacagtggcgctaccatctttcgggtaggggatcgcgtcatccagcag
cggaacgattatgatcgggatgtctacaacggtgatgttggtgagattgtcgcggttgat
cccaccgggccaacagttatggtgcgctttgaggatggtcgaaccatccgttacaacggt
ctcgatctcgatgatctcaccctggcttacgccctcagcgtccacaaaagccagggaagt
gaatacccggttgtcgtccttcccctcctgctgtcccatcagccactgctgcaacgtaac
ctgatctacaccgcagtgacccgcgctcgccagcttgtcgtgatcgttggtgatcggcga
gcggttgaggtggcgattgccgcagccaatgttgaacgccgctacaccggcctgagcatt
cggctcggtagaacctga

DBGET integrated database retrieval system