KEGG   Chloroflexus aurantiacus: Caur_0869Help
Entry
Caur_0869         CDS       T00639                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_0869
   01230 Biosynthesis of amino acids
    Caur_0869
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_0869
   00030 Pentose phosphate pathway
    Caur_0869
   00051 Fructose and mannose metabolism
    Caur_0869
   00052 Galactose metabolism
    Caur_0869
  Energy metabolism
   00680 Methane metabolism
    Caur_0869
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Caur_0869
Protein phosphatases and associated proteins [BR:cau01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Caur_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1189462..1191705
Genome map
AA seq 747 aa AA seqDB search
MTHPTIRIGVLTSGGDAPGMNAAVRAVVRTGISRGCEVFAIYEGYQGLIEGGKLIRRMDW
SSVGGIIQRGGTIIGTARSAAFRTREGRRRAAANLLAHGIDRLVVIGGDGSLTGADLFRR
EWPELLAELVAAGEISSEQAAAHPNLLIAGIVGSIDNDFCGTDMTIGADTALHRITEAID
AISSTAASHQRTFVIEVMGRNCGYLALMGAIAGGADWAFIPEMPPQMDDWEQHMCDVLRI
GREQGRRDSIVVVAEGACDRDGKPITASYVKKILEERLGEDTRVTILGHVQRGGAPSAFD
RWMSSLLGATAVEELLEADPNAEPKLIGLRENRVVRLPLMTCVRDTHQVAEAIAQRDYER
ALAMRGNSFVEAYRTLGTLIQSQPSPPDRLRRGHRFAVLHSGGPAPGMNTAVRAAVRIGI
DRGHTMLGVRNGFQGLIDGDIHEMDWMSVSGWATMGGAELGTNRKVPQGSELYQIARNIE
RFGIDGILMIGGWTGYQAIYKLYSERHIFPAFNIPMICLPATIDNNLPGSELSLGADTAL
NSIVSAIDRIKQSAVASRRCFIVEVMGRDCGYLALMSGLATGAERVYLPEEGISLRKLQA
DLDEMMRWFRAGKRLSLIIRNEKANPIYTTSFICSLFEEEGGKLFEVRQAILGHLQQGGD
PSPFDRIQATRLAVRCIEFLVEHADRREPIGAFIGYRGGKVQIHQLDDMPRLMDPVHARP
REQWWMSLRQMTDLLTTPPSPTVESGK
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgacacatccaacgatccgaattggagtcttaaccagtggtggcgatgcgccgggtatg
aacgccgcagtacgggctgttgtacgcaccggcatcagtcgtggctgtgaagtctttgca
atctacgaaggctatcagggtctgatcgaaggtggaaaattgatccggcgcatggattgg
agttccgttggcggcatcatccagcgtggcggtacgatcattggtacggcgcgcagcgcg
gcattccgcacccgcgagggccgacgccgcgcagcagcgaatctcttggcccacgggatc
gaccgcctggtcgtgatcggtggtgatggcagcctcaccggtgccgacctctttcgtcgt
gaatggccggaactgctggccgaactggtcgcagctggtgagatcagcagcgagcaggcc
gccgcccatcccaatctcctcattgccgggattgtgggcagtatcgacaatgacttctgc
ggtaccgatatgaccattggtgccgacacggcgctgcatcgtatcaccgaggcgattgat
gcaatcagctcgacggcggccagtcatcagcgtacctttgtcatcgaggtgatggggcgg
aattgtggctacctggcgctgatgggggcgattgccggtggcgcagactgggcatttatc
cctgaaatgcctccccaaatggatgactgggagcagcatatgtgcgatgtgctgcggatc
ggacgcgaacaggggcgacgcgacagcattgtggtggtagccgaaggggcgtgtgatcgc
gacgggaaaccaatcacggcttcgtatgtcaagaaaattttggaagagcgtctgggtgaa
gataccagagtgaccatcctcggccacgtgcagcgtggtggcgctcccagcgcatttgat
cgctggatgagttcattattgggggcaacggcggttgaagagttactggaagccgatccc
aatgccgaaccgaaactgatcgggttgcgtgagaatcgggttgtgcgtctaccactgatg
acctgtgtccgcgatacccatcaggttgccgaggcgattgcccagcgcgactacgaacgt
gcgctggcgatgcggggcaatagctttgtggaggcgtaccgcaccctcggcaccctcatt
cagtcgcagccctcgccccccgaccgattacggcgcgggcatcgcttcgcagtgctgcac
agtggcggcccggcaccgggaatgaatacggcggtacgggcagcggtgcggatcggcatt
gaccgcggccatacgatgctcggtgtgcgcaatgggtttcagggactgatcgatggcgac
atccacgaaatggattggatgagcgtaagtggttgggcaacgatgggtggcgccgagctg
ggcaccaatcgcaaggtgccgcaaggcagcgagctataccagattgcccgtaacatcgag
cgcttcggaattgacggtatcttgatgatcggtggttggaccgggtatcaggcaatctac
aagctgtacagcgagcgacacatcttcccggcattcaacatccctatgatctgcttgccg
gcaacgattgacaacaatcttcccggttctgagctgagtctgggtgcagataccgcattg
aacagcatcgtcagtgcaattgatcggatcaagcagtcggcggtggcttcacggcgctgt
ttcattgtcgaagttatggggcgtgactgtggttatctggccttgatgagcggattggca
accggcgccgagcgggtctacctccccgaagaaggcatcagcctgcgcaaattgcaagcc
gatctcgacgagatgatgcgctggtttcgtgctggtaagcgcctgagtttgatcattcgc
aatgaaaaagcgaatccgatctacaccacctcgttcatctgctcgttgtttgaagaagag
ggtggtaagctattcgaggtacggcaggcgattctcggtcatttgcagcagggaggtgat
ccttcgccgttcgaccgtattcaggctacccgtctggccgtgcgctgtatcgagttcctg
gtcgagcacgctgaccgtcgcgaaccaatcggggcgttcatcggctatcggggcggtaaa
gtccagatacatcagctcgacgatatgccacgcctgatggatccggtgcatgcccgtccg
cgagagcagtggtggatgtctttgcggcaaatgaccgatttgctcacgacgccgccatca
cctaccgttgagagcgggaagtaa

DBGET integrated database retrieval system