KEGG   Chloroflexus aurantiacus: Caur_1058Help
Entry
Caur_1058         CDS       T00639                                 

Definition
alpha/beta hydrolase fold-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cau  Chloroflexus aurantiacus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1464024..1464809
Genome map
AA seq 261 aa AA seqDB search
MLEPYLLSSGDHACLLIHGFVGDPGEMRDLGDHLAQAGYTVFGMRLPGHTGNPEDLIAVR
WTDWLAAVQAAFDALARRSTAVSVVGFSLGGALAALLAAQRPVHRLVMLATPYRLGGDWR
VDLLGIVRYVTPWFYLLAQADFSSPDLRASIWRRQPGLDLDDPVIQQMLRRSVKVSVAAA
DELRLTLAAARRALPLVRAPTLIMHGRSDTTADPASAAAIMAQIGSTYRELTYWPATGHQ
LLLTGPYRSAIFQRITRFLAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaccgtatttgttgtcgagtggtgatcacgcttgcttgctgatccacgggttt
gtcggcgatcccggtgagatgcgcgatctaggcgatcatctggcgcaagccggctatacg
gtatttggtatgcgtctgcccggacataccgggaaccctgaagacctgattgctgtgcgc
tggacggactggctggctgcggtgcaggcggcatttgacgcactcgcccgccggtctact
gctgtctcagtagtgggtttttcattgggtggcgcactggccgcgttgctggcagcacag
cgccctgtgcaccgcctggtgatgctggcaacaccctaccgccttggtggcgactggcgg
gttgatctgttggggattgtccgctacgtgaccccctggttttatctgctggcccaggcc
gatttcagcagccccgatctacgggcatcaatctggcgtcgccagcccggccttgatctc
gacgatccggtcattcaacagatgctacgacgctcggtgaaggtgtcagtcgccgccgct
gatgagttgcggctgactctggcagccgctcgtcgtgcactgccgctggtacgggcacca
accctgattatgcacggtcgcagtgatacaacagccgatccagccagtgccgcagctatc
atggctcagatcggcagtacttaccgtgaactcacatactggccggccaccggtcatcaa
ctgctactcaccgggccgtaccggtcggccatctttcaacggatcacacggtttctcgcc
cgctag

DBGET integrated database retrieval system