KEGG   Chloroflexus aurantiacus: Caur_1110Help
Entry
Caur_1110         CDS       T00639                                 

Definition
glycoside hydrolase family 3
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cau  Chloroflexus aurantiacus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Caur_1110
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Caur_1110
Enzymes [BR:cau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Caur_1110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1548808..1550355
Genome map
AA seq 515 aa AA seqDB search
MNALSEQLLIWFAGDEVPSHLPDLIFNHRVAGVTLYRHLNGASPARIRALTAHLQQLAAA
SGYGPLLIGADQEGGQLQALPGLTAFPGAMALGATQSPALAFRVGSAIGAELAALGVNLV
YAPVCDVNTNPQNPVIGIRAFGDDPKIVGVLAAAMIAGLQQHGVAATAKHFPGHGDTFGD
SHYGLVRVNHDYERLQHVEWLPFSAAIEAGVQAVMVGHLAVPALQAADRPATRAPQVIAH
LRHHLGFRGVTISDALDMKAFAPDDGYARALSEAVHAGIDLLLLGAGNDLEQTIKFLSTI
DRNTKSTISSQRIAALRQWLRNRPQPDLSVVGCAAHHALADEVAQRALTLVRNQEGLLPL
QLSTTARVVVIMPQPVDLTPADTSASERPALAEAILSCHSYVQSFIIDIDPSPASIADIL
AALAEADLVIIGTINAQTYRGQASLVHEIFQRGIPLITVALRLPTDLLAYPEVSTHLCTY
SLQPVALKALAAGLWGEIPFQGKLPLRVLSEEFNV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattgagtgaacaactactaatctggttcgccggtgatgaagtaccatcacat
ctgccggacctgatcttcaaccatcgcgttgccggtgtgacgctctatcgccacctcaat
ggcgcatcaccagcccgtatccgtgcattaaccgcgcatttacagcaactggcagcagcc
tcgggctacggtcctctcttaatcggtgccgatcaggagggtggtcaattgcaagcctta
ccgggattaaccgcttttcccggtgcaatggcattaggagcaacccaatcgccagctttg
gcctttcgtgttggcagtgcaatcggggcggaactggcagcacttggggttaacctggtc
tatgccccggtttgtgatgttaatacgaacccacaaaacccggtcatcgggatccgtgcc
tttggcgatgaccccaagatcgtcggagtactggctgcggcaatgattgccggcctgcag
cagcatggagttgccgcaacagccaagcactttcccggccacggagatacgtttggtgat
agtcattatggtctggttagggttaatcacgattacgaacgattacagcacgtagaatgg
ttgccattttcggcggctatcgaggctggtgttcaggcagtgatggttggacatctggct
gtacctgcattgcaggcagcggatcgccctgccacccgcgcaccacaggtcatagcgcat
ctgcggcatcacctcggattcagaggtgttacgattagcgatgcactcgacatgaaagcc
tttgcacctgacgatggatatgccagagctttgtcggaagcagttcatgcaggtatcgat
ctgctcttgctcggtgcaggaaatgatctggagcagacaataaagtttctcagtacaatt
gatagaaacactaaaagtactatttccagccagcgcattgcggcgctgcgccaatggctg
cggaatcgtcctcaaccagatctatcagttgtcggatgtgcagctcatcacgcgctggca
gatgaggtggcgcagcgcgcattaaccctggtgcgcaatcaggaaggcttattaccacta
caattatcaacaacagcccgtgtcgtggtaatcatgccgcaacccgttgatcttacccct
gccgacacatcagcaagtgaacggcctgcacttgccgaggcgatcctttcttgccattct
tatgttcagtccttcattatcgatattgatccctctccagccagcattgccgatattcta
gctgctctcgccgaagccgatctggtgatcataggaacaatcaacgcccaaacgtatcgt
ggtcaggcttcgctcgtacacgagatctttcaaagaggcattcccctgattaccgtagca
ttacgtctccccaccgatttgctcgcctacccggaagtgtcaacgcatctctgtacttat
agtttgcaaccggtagccttgaaagcacttgctgctggcctatggggtgaaattccattc
cagggtaagctaccattacgagtattgtctgaggaatttaatgtatga

DBGET integrated database retrieval system