KEGG   Chloroflexus aurantiacus: Caur_1121Help
Entry
Caur_1121         CDS       T00639                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00020  Citrate cycle (TCA cycle)
cau00640  Propanoate metabolism
cau00660  C5-Branched dibasic acid metabolism
cau00720  Carbon fixation pathways in prokaryotes
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01130  Biosynthesis of antibiotics
cau01200  Carbon metabolism
Module
cau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caur_1121 (sucC)
   00640 Propanoate metabolism
    Caur_1121 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Caur_1121 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Caur_1121 (sucC)
Enzymes [BR:cau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Caur_1121 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 5825922
NCBI-ProteinID: YP_001634740
UniProt: A9WJ74
Position
complement(1560783..1561925)
Genome map
AA seq 380 aa AA seqDB search
MKLHEYQARDLLARFGIPVTGGGVAVTPVEARTIAAEIGGPVVVKAQVHVGGRGKAGGVK
LAQTPTEAEQVARQILGMNIKGLTVEKVLVAEAVSYKRELYLSAILDRGSKRVMMIASAE
GGVEIEEVAKTNPDAIIKIPAHPTMGLLDFQARELAFRIGLNDGKQARQFAQIASALYRA
FVECDASLVEINPLVVKADGSLLALDSKILLDESALFRHPDLAALHDPSAEPEAERRARE
AGITYIKLDGNIGCMVNGAGLAMATMDVIKLSGGEPANFLDIGGGAGKEKVKAALQIILS
DPNVKAVLFNIFGGITRVDEVARGIIAALEEVPTDVPMVARLVGTNEEAGRALLAESKLI
PAATLAEGAQKAVAAARGEL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatgaatatcaggctcgcgacctgttagcccgttttggtattccggtgaca
ggtggcggggtagcggttacaccggtggaagcacgcaccatcgccgcagagatcggcggc
ccggtcgtggtgaaagcccaggtacatgttggtggacgtggtaaggctggtggtgtaaag
ctggcgcaaaccccaactgaggccgagcaggttgccagacagattcttggcatgaacatc
aaggggttgacggtggagaaggtattggttgccgaagcggtgagctacaagcgcgagctg
tacctttcggccatccttgatcgcggcagcaagcgcgtgatgatgattgcctcggctgaa
ggtggggttgaaattgaagaagtagcgaagacgaaccccgacgccatcattaagattccg
gcccatccaacgatgggtctgctcgattttcaggcccgggaactggcatttcgcattggc
ttaaacgatggcaagcaagcgcgtcagttcgcacaaattgccagtgctctgtatcgagct
tttgttgagtgtgatgcctcactggtggagatcaatccgttggttgtcaaggccgacggc
agcctgcttgccctcgactcgaaaattctcctcgatgagagtgcgctattccgccatccc
gatctggctgccctgcacgatccctctgccgagccggaagctgagcggcgtgcccgcgaa
gcgggtatcacctatattaagctcgatggcaacattggctgcatggtcaatggtgccggt
ctggcgatggccaccatggatgtgattaagctgtcaggtggcgagccggccaatttcctt
gatattggtggtggtgccggcaaagagaaggtcaaagccgctttacagatcattctctct
gatccaaacgtgaaggcggtgttgtttaatatctttggtgggattacgcgggtcgacgaa
gtggcacgcgggattattgctgcgctcgaagaggtgccaaccgatgtgccgatggtggcc
cggctggtggggacaaatgaagaagccggacgggcactgctggccgagtcgaagttgatc
cctgcggcaacgctggctgagggtgcgcagaaggcagtagcagccgctcgcggtgagtta
taa

DBGET integrated database retrieval system