KEGG   Chloroflexus aurantiacus: Caur_1121Help
Entry
Caur_1121         CDS       T00639                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cau  Chloroflexus aurantiacus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_1121 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caur_1121 (sucC)
   00640 Propanoate metabolism
    Caur_1121 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Caur_1121 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Caur_1121 (sucC)
Enzymes [BR:cau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Caur_1121 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1560783..1561925)
Genome map
AA seq 380 aa AA seqDB search
MKLHEYQARDLLARFGIPVTGGGVAVTPVEARTIAAEIGGPVVVKAQVHVGGRGKAGGVK
LAQTPTEAEQVARQILGMNIKGLTVEKVLVAEAVSYKRELYLSAILDRGSKRVMMIASAE
GGVEIEEVAKTNPDAIIKIPAHPTMGLLDFQARELAFRIGLNDGKQARQFAQIASALYRA
FVECDASLVEINPLVVKADGSLLALDSKILLDESALFRHPDLAALHDPSAEPEAERRARE
AGITYIKLDGNIGCMVNGAGLAMATMDVIKLSGGEPANFLDIGGGAGKEKVKAALQIILS
DPNVKAVLFNIFGGITRVDEVARGIIAALEEVPTDVPMVARLVGTNEEAGRALLAESKLI
PAATLAEGAQKAVAAARGEL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcatgaatatcaggctcgcgacctgttagcccgttttggtattccggtgaca
ggtggcggggtagcggttacaccggtggaagcacgcaccatcgccgcagagatcggcggc
ccggtcgtggtgaaagcccaggtacatgttggtggacgtggtaaggctggtggtgtaaag
ctggcgcaaaccccaactgaggccgagcaggttgccagacagattcttggcatgaacatc
aaggggttgacggtggagaaggtattggttgccgaagcggtgagctacaagcgcgagctg
tacctttcggccatccttgatcgcggcagcaagcgcgtgatgatgattgcctcggctgaa
ggtggggttgaaattgaagaagtagcgaagacgaaccccgacgccatcattaagattccg
gcccatccaacgatgggtctgctcgattttcaggcccgggaactggcatttcgcattggc
ttaaacgatggcaagcaagcgcgtcagttcgcacaaattgccagtgctctgtatcgagct
tttgttgagtgtgatgcctcactggtggagatcaatccgttggttgtcaaggccgacggc
agcctgcttgccctcgactcgaaaattctcctcgatgagagtgcgctattccgccatccc
gatctggctgccctgcacgatccctctgccgagccggaagctgagcggcgtgcccgcgaa
gcgggtatcacctatattaagctcgatggcaacattggctgcatggtcaatggtgccggt
ctggcgatggccaccatggatgtgattaagctgtcaggtggcgagccggccaatttcctt
gatattggtggtggtgccggcaaagagaaggtcaaagccgctttacagatcattctctct
gatccaaacgtgaaggcggtgttgtttaatatctttggtgggattacgcgggtcgacgaa
gtggcacgcgggattattgctgcgctcgaagaggtgccaaccgatgtgccgatggtggcc
cggctggtggggacaaatgaagaagccggacgggcactgctggccgagtcgaagttgatc
cctgcggcaacgctggctgagggtgcgcagaaggcagtagcagccgctcgcggtgagtta
taa

DBGET integrated database retrieval system