KEGG   Chloroflexus aurantiacus: Caur_1161Help
Entry
Caur_1161         CDS       T00639                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cau  Chloroflexus aurantiacus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cau00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1623046..1625079
Genome map
AA seq 677 aa AA seqDB search
MSDTEKPRRTRRKQVANTDEPSTTVTASTTDAPTATIEEPSAAARAMMTSILSEDDIYLF
NQGTHYRLYDKFGAQPVVLEGVPGTYFAVWAPNAEYVAVIGDWNNWDAGANPLRQRGFSG
VWEGFIPHVGKGMRYKFHIASRYYGYREDKTDPFGTYFEVAPQTAAIIWDRDYTWSDQQW
MSERGQRQRLDAPISIYEVHLGSWRRKPEEDNRPLNYRELAHELVEHVKDCGFTHVELLP
VTEHPFYGSWGYQSTGMFAPTSRYGTPQDFMYFVDYLHQNGIGVILDWVPSHFPTDGHGL
AYFDGTHLYEHADPRKGYHPDWGSYIYNYGRNEVRSFLISSALCWLDKFHIDGIRVDAVA
SMLYLDYSRRAGEWIPNEYGGNENLEAISFLRELNTQIYKYYPDVQTIAEESTAWPMVSR
PVYVGGLGFGFKWDMGWMHDTLQYFRRDPIYRRFHHNELTFRGLYMFSENYVLPLSHDEV
VHGKGSLLDKMAGDVWQKFANLRLLYSYMFAQPGKKLLFMGGEFGQWREWSHDTSLDWHL
LMFPSHQGVQRLIGDLNRLYRTEPALHELDCDPRGFEWIDANDADASVYSFLRKSRYGEQ
ILIVINATPVVREDYRIGVPVGGWWRELFNSDSEYYWGSGQGNAGGVMAEAIPTHGRDFS
LRLRLPPLGALFLKPAG
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgagtgataccgaaaaacctcgccgcacccgccgtaaacaggtggcgaatactgatgag
ccttccacgacagtgacggcctcgaccacggatgcaccaaccgcaaccattgaggaacct
tcggcggctgctcgtgctatgatgaccagtatcctcagcgaggatgatatttatctgttc
aaccagggcacccattaccgcttgtacgacaaatttggtgctcagccggtggtgctggaa
ggtgtaccgggcacctattttgcggtttgggcaccaaatgccgagtatgtggccgtgatc
ggcgactggaataactgggacgccggtgccaacccgctccggcagcgcggcttttcgggt
gtgtgggagggatttatcccccacgtcggtaaaggcatgcgctacaagttccacatcgcc
tcgcgctactacggctatcgcgaagacaagacagatcccttcggcacctacttcgaggtc
gcaccgcagacggctgccattatctgggatcgcgattacacctggtcggatcaacagtgg
atgagcgaacgggggcagcggcagcgcctcgatgcgccgatctccatctacgaagtgcat
ttgggatcgtggcggcgcaaaccggaagaggataaccgtccgctcaattaccgtgaactg
gcccacgagctggtcgagcatgtgaaagattgtggctttacccacgttgagctgttaccg
gtcaccgagcatcccttctacggttcctgggggtatcaatcgacgggtatgttcgcgccg
accagccggtacggaacgccgcaagacttcatgtattttgtggattatctgcatcaaaac
gggattggggtgatcctcgattgggtgcccagccacttcccgaccgacggtcatgggctg
gcctacttcgatggtacccatctctacgaacacgccgatccgcgtaaaggctaccatccc
gactggggaagctatatttacaactatggtcggaacgaggtacgaagcttcctgatcagc
tcggcgctctgctggctggataagtttcacattgacgggatacgggttgatgcggttgcg
agcatgctctatctcgactattcgcgccgagccggcgagtggattcccaacgaatacggt
gggaacgaaaatctggaggcgattagcttcctgcgcgaattgaacacccagatttacaag
tactaccctgatgtgcagacaattgccgaggagagcacagcctggccgatggtatcgcga
ccggtctacgttggtggattgggcttcggcttcaagtgggacatgggctggatgcacgat
accctgcagtatttccggcgcgatccgatctaccggcgctttcatcacaacgaattgacc
ttccgtggcctctacatgttcagcgagaactacgtgctaccactctcgcacgatgaggtc
gttcacggcaaagggtcactgctcgacaagatggccggcgatgtctggcaaaagtttgcc
aacctgcgcctgctctacagctatatgtttgctcaacccggtaaaaaactgctcttcatg
ggtggtgaattcggacagtggcgcgaatggtcacacgacaccagcctggactggcactta
ctgatgtttccctcccatcagggcgtacaacgattgattggcgatcttaaccgtctctac
cgtactgagccggccttgcacgaactggactgtgatccacgtgggtttgagtggatcgat
gccaatgatgccgatgccagcgtctacagctttctgcgcaagagccgctacggcgagcaa
attctgatcgtgatcaatgccacgccggtcgtgcgtgaggattaccgaattggggtaccg
gtgggtggctggtggcgtgaattgtttaacagcgactcggagtattattggggaagtggg
caaggcaatgccggcggcgtgatggccgaagcaattccaacccatggccgggatttttcg
ttgcgactgcgcctgccgcccctgggtgcgctcttcctgaaacctgccggctaa

DBGET integrated database retrieval system