KEGG   Chloroflexus aurantiacus: Caur_1199Help
Entry
Caur_1199         CDS       T00639                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
cau  Chloroflexus aurantiacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_1199
Enzymes [BR:cau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Caur_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(1677805..1678449)
Genome map
AA seq 214 aa AA seqDB search
MTARSRHTSIWLVRHGQTEANRHRRYLGRGDSPLTDYGRRQHAALARRLRALPFTRVIVS
PTERTRALAAAILDGRSPIPVLEDPRWREIDHGRWEGLTYREVMQRFPAEAQARWAAGID
GRPAEGESLADVANRLAPAWDEVLTQYPGERILIVTHATPIQLVICWCCGQPIAEHWRWR
VDLGSITALDTYGTTIIVRTVNAVPRLVGAGESV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctcgttcgcgccataccagtatctggcttgttcgtcatgggcagacggaggca
aaccgccaccggcggtatctcggtcgcggtgacagcccgttgaccgattatggtcggcgt
cagcacgctgccctggcccggcggttgcgggcactgcccttcacccgcgttattgtcagc
cctacggaacgcactcgcgcgctggcggctgcgattctcgatggtcgttcacccattccg
gtactcgaagacccgcgctggcgcgagattgaccacgggcgttgggaaggcttaacctac
cgggaagtgatgcagcgattcccggctgaagcccaggcgcgctgggctgccgggattgac
gggcggcctgctgagggtgagagtctggctgatgttgccaaccggctggctccggcctgg
gacgaggtgctgacccaatatcccggtgagcgaattctgatcgtaacccacgccacccct
atccaactggtgatctgctggtgctgcgggcagccgatagccgaacactggcgctggcgg
gttgatttggggagtataacggccctcgacacctacggtacgacgatcattgtccgcacc
gttaacgcggttccgcggttggtgggtgcaggagagagcgtatga

DBGET integrated database retrieval system