KEGG   Chloroflexus aurantiacus: Caur_1365Help
Entry
Caur_1365         CDS       T00639                                 

Definition
binding-protein-dependent transport system inner membrane protein
Orthology
K02033  
peptide/nickel transport system permease protein
Organism
cau  Chloroflexus aurantiacus
Module
Peptides/nickel transport system
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1882334..1883293
Genome map
AA seq 319 aa AA seqDB search
MIRYLLRRIVLLGGTVLISSLIIFLICRLLPGDVARVLLGREAGEAALAALRAELGLDRP
LPLQYIDWLRGLLTGDWGIAYSTRQPIRPLVMERLSNSLLLAGTTLALALPLGIGLGVWA
GWRAGKPDDTVISVSTLAVTGLPEFVTGLLLIDLFAFRLRWLPANSSIRPDTSFFEVLPQ
LVLPAITATLVLLAYIARLTRTGVIAEREQEYVRTAMLKGLSPATILRRHVLRNALLPAI
TVIAISLGWLISGLIVVENVYNYPGIGRLLTFAIDRRDLLLLQAVAMITVVIFAVANLLA
DLMYALLDPRIRLGDERSS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgatacgttatctgttacgacgaatagtgttgctcggcggcactgtgctgatcagctca
ttgatcatctttctgatctgtcgcctcttacccggtgatgtagcccgagtcctcctcggt
cgcgaagccggtgaagcggcgctggctgcactgcgtgccgaactggggttggatcggcca
ttgccactccaatacattgattggctgagaggacttctcaccggcgattggggcatcgca
tacagcacacgccaaccgattcgaccgctggtcatggaacgcctgagcaattcactcctg
ctggccggcacaacattagccctcgcactgccgttggggattgggttgggggtatgggcc
ggctggcgggccggcaaacccgacgacacagtcatcagcgtctcaaccctggcggtcacc
ggtctaccagagtttgtcaccggcctcctgctcatcgatctcttcgcctttcgcctgcgc
tggctaccggccaactcatcgatccggccagacacctcattcttcgaggtactcccccaa
ctggtattgccggcaatcacggccacgctggtactgctggcctacatcgcccggctaacg
cgcaccggggtgatcgccgaacgtgagcaggaatatgtccgcaccgcgatgctaaaagga
ctgtcaccggcaacgattctccgccgacacgtcttacgcaatgccttattgccggccatt
acggtgattgccatcagcctcggctggctgattagcggcctgatcgtggtcgaaaacgtc
tacaactatccgggtattgggcgtctgttgacctttgccatcgaccgccgcgatctcttg
ctgctccaggcggtagcgatgattaccgtcgtgatctttgctgtcgccaatctgctggcc
gatctcatgtatgccctcctcgacccccgcatccggctcggtgacgaacgcagctcttga

DBGET integrated database retrieval system