KEGG   Chloroflexus aurantiacus: Caur_1390Help
Entry
Caur_1390         CDS       T00639                                 

Gene name
trpC
Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cau  Chloroflexus aurantiacus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cau01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cau00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1927346..1928203
Genome map
AA seq 285 aa AA seqDB search
MRVEATDGTCYQGQLMSEPTILEQILAHKRVEVRRQQAKIPLAALHDRIRHAPPIRDFAA
ALRRGPATALIAEVKKASPSRGVLLANFDHLALARTYVANGAAALSVLTDQRFFQGSLTY
LAGIRALPDIQAAGTPLLRKDFIIDPYQVYEARAYGADAILLIVAALDDQTLAELFTLTY
ELGMHALVEVHTVAELERALRIQPPIIGVNNRDLHRFVTDRTTTRNIADHLPSGTQRPLL
VSESGIFTPDHVAEVRGYGADAILVGEALVTAPDIGLQVRTLATA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcgaagcaaccgacggcacatgctaccagggacaactcatgagcgaaccaacc
attctggaacagatattagcccacaaacgagtggaagtacgtcgtcaacaagccaaaatt
ccccttgctgctctgcatgaccggattcggcatgcgccaccgattcgtgatttcgccgct
gcactacgccgggggccggcaacggccctcattgctgaggtcaagaaggcctcacccagt
cgtggtgtgttgctggccaacttcgaccatctggccctggcccgtacctacgtggccaac
ggcgcggcggcattgtcggtattgaccgatcagcgattctttcaggggagcctgacctac
ctggccggtattcgtgcgctgcccgacattcaggcagcaggcacacccttgcttcggaaa
gatttcatcatcgatccgtaccaggtctatgaagcgcgcgcctacggtgctgacgccatt
ttgttaattgtggctgcactcgatgatcagacactggctgaacttttcaccctaacctat
gaactgggaatgcatgccctggtagaggtacacactgtggctgagttggaacgagcacta
cgcatccaaccaccaatcattggggtgaacaaccgtgatctgcaccgattcgtgactgac
cgcacgacaacccggaacatagcagatcatctgccatcaggaacgcaacgaccactgcta
gtcagtgagagcggtatttttacccccgaccacgtcgccgaggtgcggggctacggtgcc
gacgcgatcctggtcggagaggcattagtaacagcaccggatattgggcttcaggtgcga
acgctagcgaccgcataa

DBGET integrated database retrieval system