KEGG   Chloroflexus aurantiacus: Caur_1390Help
Entry
Caur_1390         CDS       T00639                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01130  Biosynthesis of antibiotics
cau01230  Biosynthesis of amino acids
Module
cau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Caur_1390 (trpC)
Enzymes [BR:cau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Caur_1390 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C ThiG
Motif
Other DBs
NCBI-GeneID: 5828495
NCBI-ProteinID: YP_001635007
UniProt: A9W9Y2
Position
1927346..1928203
Genome map
AA seq 285 aa AA seqDB search
MRVEATDGTCYQGQLMSEPTILEQILAHKRVEVRRQQAKIPLAALHDRIRHAPPIRDFAA
ALRRGPATALIAEVKKASPSRGVLLANFDHLALARTYVANGAAALSVLTDQRFFQGSLTY
LAGIRALPDIQAAGTPLLRKDFIIDPYQVYEARAYGADAILLIVAALDDQTLAELFTLTY
ELGMHALVEVHTVAELERALRIQPPIIGVNNRDLHRFVTDRTTTRNIADHLPSGTQRPLL
VSESGIFTPDHVAEVRGYGADAILVGEALVTAPDIGLQVRTLATA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcgaagcaaccgacggcacatgctaccagggacaactcatgagcgaaccaacc
attctggaacagatattagcccacaaacgagtggaagtacgtcgtcaacaagccaaaatt
ccccttgctgctctgcatgaccggattcggcatgcgccaccgattcgtgatttcgccgct
gcactacgccgggggccggcaacggccctcattgctgaggtcaagaaggcctcacccagt
cgtggtgtgttgctggccaacttcgaccatctggccctggcccgtacctacgtggccaac
ggcgcggcggcattgtcggtattgaccgatcagcgattctttcaggggagcctgacctac
ctggccggtattcgtgcgctgcccgacattcaggcagcaggcacacccttgcttcggaaa
gatttcatcatcgatccgtaccaggtctatgaagcgcgcgcctacggtgctgacgccatt
ttgttaattgtggctgcactcgatgatcagacactggctgaacttttcaccctaacctat
gaactgggaatgcatgccctggtagaggtacacactgtggctgagttggaacgagcacta
cgcatccaaccaccaatcattggggtgaacaaccgtgatctgcaccgattcgtgactgac
cgcacgacaacccggaacatagcagatcatctgccatcaggaacgcaacgaccactgcta
gtcagtgagagcggtatttttacccccgaccacgtcgccgaggtgcggggctacggtgcc
gacgcgatcctggtcggagaggcattagtaacagcaccggatattgggcttcaggtgcga
acgctagcgaccgcataa

DBGET integrated database retrieval system