KEGG   Chloroflexus aurantiacus: Caur_1534Help
Entry
Caur_1534         CDS       T00639                                 

Definition
(RefSeq) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00330  Arginine and proline metabolism
cau00332  Carbapenem biosynthesis
cau01100  Metabolic pathways
cau01130  Biosynthesis of antibiotics
cau01230  Biosynthesis of amino acids
Module
cau_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Caur_1534
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Caur_1534
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Caur_1534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-GeneID: 5828640
NCBI-ProteinID: YP_001635142
UniProt: A9WAX2
Position
2102991..2104148
Genome map
AA seq 385 aa AA seqDB search
MNSPSLLQSSECRAVQIMSRFVVKLGTSVLTAGTDRLHRPYFVELARQIVRLKDAGHEVV
LVSSGAVAAGKERLGVNPHHRSNIPLKQVFAAVGQSRLMHIYEQIFELYGLQVAQALLTR
DDLRDRRRYLNARNTLTLCLEQGIVPIINENDAVVTAEIRVGDNDNLSALVAGLIDADLL
LILTDIDGVYSADPRSDPNAELIREIPVIDERVWAIAGGSGTHRGTGGMQTKIQAADLAT
RSGVAVVIAAGHEPDVIVRVANGERIGTFFPATTTHPDARQRWILAETVRHSRIVVDEGA
TTALTRHGKSLLAAGICEVSGEFDRGQTVRIFARDGREIARGLTQYRSSDLRMIAGLRSS
QIVSVLGYDYGPEVVHRDDMVVLSG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgccctcattgttacaaagcagcgaatgtagagcagtacagattatgagccga
ttcgttgtcaaactaggtacaagcgtcttaacggccggcacagatcgcctccatcgccct
tactttgtcgaactggcccgccaaatcgttcgtctgaaagatgccggtcacgaagtcgtc
cttgtctcatcaggggctgttgccgcaggcaaagaacgccttggtgtcaatcctcatcac
cgcagcaatattcccctgaagcaggtctttgctgcggtcggtcagagtcgcctgatgcac
atttacgaacaaatctttgagttgtacggtttacaggttgcgcaagccctgctcacccgt
gacgacctgcgcgaccgacggcgttacctcaatgcccgtaatacgctcaccctttgcctg
gagcagggtatcgtgccaatcatcaatgaaaacgatgctgtcgtcactgccgagattcga
gtgggcgacaacgacaacctctcagcactggtggccggcttgatcgacgctgacctgctc
ttaattttgaccgacattgatggggtgtacagcgccgatccacgcagtgatccaaacgcg
gaactgatccgcgaaataccagttattgacgaacgtgtctgggcgatagccggtggcagc
ggtacccatcgtggcaccggcggcatgcagacgaagattcaggctgccgatctggccacc
cgttcaggcgtagctgtggtgattgcagccggccacgagccagatgtgattgtacgggtg
gcgaatggtgaacgtatcggaaccttcttcccggctaccacaactcaccccgatgcgcga
cagcggtggattctggccgaaacagttcgtcattcgcgcattgtggtggatgaaggcgca
acgaccgcgctgacccgacacggcaagagtctgctggccgcgggtatctgcgaggtgagt
ggtgagtttgaccgcgggcaaactgtgcgcatctttgcccgcgatgggcgcgagatagcg
cgcggcctgacccagtaccgatccagcgatctccgtatgattgccggtctccgttcatca
cagatcgtttccgttttagggtatgattatgggccggaggtcgtccatcgcgacgatatg
gttgtactgagtgggtag

DBGET integrated database retrieval system