KEGG   Chloroflexus aurantiacus: Caur_1691Help
Entry
Caur_1691         CDS       T00639                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cau  Chloroflexus aurantiacus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_1691
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caur_1691
  Amino acid metabolism
   00310 Lysine degradation
    Caur_1691
Enzymes [BR:cau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caur_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2324457..2325791)
Genome map
AA seq 444 aa AA seqDB search
MIDIKMPQLGESVTEGTVGRWLKRPGDPVAKYEPLLEVVTDKVDTEVPAPEAGVLHEILV
PEGETVRVGTVIARLAPAGATVPATPASAPAATTVAATASATTTVTATVAPPVADGRNTY
LSPVVARLLSEHNLDPGQIRGTGQGGRITKQDVLRFLAERQQQPSAPVAAPVAPTPVAPS
PAPAPAPAPVSPTPAPTPAPTPAPAPAPATFDIPADAELVPLTPMRRSIAEHMVRSVRTS
PHVTTVMEVDLSRVIAHRAAHQEAFSRQGVRLTMTPYFVMAAVAGLQAVPVFNGSFTDQG
IILHRRINIGVAVALQEGLLVPVIPDADEKNLLGLARAVSDLAERARTKRLRPEETQGGT
FTITNHGVTGSLFATPIINQPQAGILGVGAIVKRPVVITQNGLDAIAIRPLCYLSFTFDH
RIADGATADQFLATVKKRLEEWEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatatcaaaatgcctcagctcggtgagagtgtcaccgagggcacagttgggcgc
tggctcaagcggcccggcgatccggtcgctaaatacgaaccgctgctcgaagtggtgaca
gacaaagttgacaccgaagtgccggctcctgaagccggcgtactccacgagattctggta
ccggagggggagacagtgcgggtcgggacggtcatcgcgcgcctggccccggcaggcgca
acggtacctgcaacaccggcttcggcaccagccgcaaccaccgtcgccgcaacggcatca
gctaccaccaccgtgacggctaccgtagctccaccggtagcagatgggcgtaacacctat
ctttcgccggtggttgcccgcttactgtccgagcacaacctcgatcccggccagattcgc
ggtaccggtcagggtggccgtatcaccaagcaggacgtgttgcgcttcctggccgaacga
caacaacaaccgtctgcgccggtggcggcgccggtcgctcccacccctgtcgcaccctcg
ccggccccggcaccagcccccgcaccggtaagtccaaccccggcaccgaccccggcaccg
accccggcaccagcccctgcaccggcaaccttcgatattcctgcggatgcagaattggtg
ccactcaccccgatgcgacgcagtattgccgaacatatggtacgttcggtgcgcacctca
ccccacgtgaccacggtgatggaggtcgatctgagtcgcgtcattgcccatcgcgccgcc
caccaggaagcgttcagtcgccagggtgtgcgtctgaccatgaccccctattttgtgatg
gcagcagttgccggcctccaggcagtgccggtgttcaacggcagtttcaccgaccagggg
atcatcctgcatcggcggatcaacatcggcgtagcggtcgcgctgcaggaaggcttgctg
gtgccggtaatccctgatgccgacgagaagaatctgctcggtctggcccgtgccgtcagc
gacctcgccgagcgcgctcgcaccaaacgattgcgcccggaagagacccagggtggtacc
ttcactatcaccaatcacggtgtgaccggcagcctcttcgccaccccgatcatcaaccag
ccccaggccggcatcctcggcgtcggcgcgattgtcaaacgcccggtcgtgatcacgcaa
aacgggcttgatgcaatcgccattcgtccgctctgttacctctcattcaccttcgatcac
cggattgccgatggcgcgaccgccgatcagttcctggcaacggtgaaaaaacgccttgaa
gagtgggaaggatag

DBGET integrated database retrieval system