KEGG   Chloroflexus aurantiacus: Caur_1691Help
Entry
Caur_1691         CDS       T00639                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cau  Chloroflexus aurantiacus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_1691
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caur_1691
  Amino acid metabolism
   00310 Lysine degradation
    Caur_1691
Enzymes [BR:cau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caur_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2324457..2325791)
Genome map
AA seq 444 aa AA seqDB search
MIDIKMPQLGESVTEGTVGRWLKRPGDPVAKYEPLLEVVTDKVDTEVPAPEAGVLHEILV
PEGETVRVGTVIARLAPAGATVPATPASAPAATTVAATASATTTVTATVAPPVADGRNTY
LSPVVARLLSEHNLDPGQIRGTGQGGRITKQDVLRFLAERQQQPSAPVAAPVAPTPVAPS
PAPAPAPAPVSPTPAPTPAPTPAPAPAPATFDIPADAELVPLTPMRRSIAEHMVRSVRTS
PHVTTVMEVDLSRVIAHRAAHQEAFSRQGVRLTMTPYFVMAAVAGLQAVPVFNGSFTDQG
IILHRRINIGVAVALQEGLLVPVIPDADEKNLLGLARAVSDLAERARTKRLRPEETQGGT
FTITNHGVTGSLFATPIINQPQAGILGVGAIVKRPVVITQNGLDAIAIRPLCYLSFTFDH
RIADGATADQFLATVKKRLEEWEG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatatcaaaatgcctcagctcggtgagagtgtcaccgagggcacagttgggcgc
tggctcaagcggcccggcgatccggtcgctaaatacgaaccgctgctcgaagtggtgaca
gacaaagttgacaccgaagtgccggctcctgaagccggcgtactccacgagattctggta
ccggagggggagacagtgcgggtcgggacggtcatcgcgcgcctggccccggcaggcgca
acggtacctgcaacaccggcttcggcaccagccgcaaccaccgtcgccgcaacggcatca
gctaccaccaccgtgacggctaccgtagctccaccggtagcagatgggcgtaacacctat
ctttcgccggtggttgcccgcttactgtccgagcacaacctcgatcccggccagattcgc
ggtaccggtcagggtggccgtatcaccaagcaggacgtgttgcgcttcctggccgaacga
caacaacaaccgtctgcgccggtggcggcgccggtcgctcccacccctgtcgcaccctcg
ccggccccggcaccagcccccgcaccggtaagtccaaccccggcaccgaccccggcaccg
accccggcaccagcccctgcaccggcaaccttcgatattcctgcggatgcagaattggtg
ccactcaccccgatgcgacgcagtattgccgaacatatggtacgttcggtgcgcacctca
ccccacgtgaccacggtgatggaggtcgatctgagtcgcgtcattgcccatcgcgccgcc
caccaggaagcgttcagtcgccagggtgtgcgtctgaccatgaccccctattttgtgatg
gcagcagttgccggcctccaggcagtgccggtgttcaacggcagtttcaccgaccagggg
atcatcctgcatcggcggatcaacatcggcgtagcggtcgcgctgcaggaaggcttgctg
gtgccggtaatccctgatgccgacgagaagaatctgctcggtctggcccgtgccgtcagc
gacctcgccgagcgcgctcgcaccaaacgattgcgcccggaagagacccagggtggtacc
ttcactatcaccaatcacggtgtgaccggcagcctcttcgccaccccgatcatcaaccag
ccccaggccggcatcctcggcgtcggcgcgattgtcaaacgcccggtcgtgatcacgcaa
aacgggcttgatgcaatcgccattcgtccgctctgttacctctcattcaccttcgatcac
cggattgccgatggcgcgaccgccgatcagttcctggcaacggtgaaaaaacgccttgaa
gagtgggaaggatag

DBGET integrated database retrieval system