KEGG   Chloroflexus aurantiacus: Caur_1697Help
Entry
Caur_1697         CDS       T00639                                 

Definition
(RefSeq) peptidase M42 family protein
Organism
cau  Chloroflexus aurantiacus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2331770..2332834
Genome map
AA seq 354 aa AA seqDB search
MELAQISFLKRLLATPGPSGDEDQAARVWRAEARTFADQVYSDVLGNSFAVLEGSGPRIL
LAGHIDEIGLMISHIDDQGFLFFSPIGGWDAQVLVGQRVRLLGKNGDVIGVIGKKPIHLL
KPDERNQATKIEQMWIDIGATSKSEASELVQVGDVGVIDAPVYELPGGRIVSRSIDNRIG
AFTVLEALRLLSQNRPNAHVAAVATTQEEITFGGATTAAFSFDPQIALVVDVTFATDHPD
SDQRQWNVVKLGGGPVLSRGSANSGRVFRRLVELAEREAIPYSVQISPRYTGTDADAIHH
VRGGIASAVISIPNRYMHSPNEMIALHDVECAVRLIAAFVHSVSNVNEFIPQDE
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgcacaaatctcctttctgaaacggctgctcgctacgcctggcccttcgggt
gacgaagatcaggcagcgcgggtatggcgggccgaagcgcgcacgtttgccgatcaggtc
tatagtgatgtgctaggcaacagctttgcggtgttggaaggcagtgggccacggattctg
ctggctggtcatatcgatgagattggcttgatgatcagccatatcgacgatcaaggcttt
ctgttctttagcccgattggtggttgggatgcgcaggttctggttggtcagcgtgtgcgc
ttgctgggcaagaacggtgacgtgataggggtgatcgggaagaagccgattcacctgctc
aagcccgacgaacgcaatcaggccacgaaaatcgaacagatgtggattgatattggggcg
acgagcaagagcgaagccagtgaactggttcaggtcggcgatgttggcgtcattgacgca
ccggtctacgagctaccgggggggcgcattgtcagtcgctctatcgacaaccggatcggt
gcctttaccgttctggaagccttgcgtctactcagccagaatcggcccaacgctcacgtg
gcggctgttgccacaactcaggaagagatcacctttggcggagcaacgacggcggcgttc
agtttcgatccacagattgcgctggtggtagatgtcacttttgctaccgaccaccccgac
tcggatcagcgccagtggaacgtggtcaaactgggtggtggcccggtgttgtcacgcggc
tcagccaacagtggtcgggtttttcggcggctggttgagctggccgagcgcgaagcgatc
ccgtacagtgtgcaaatctcgccacggtacaccggtaccgatgccgacgcgatccatcat
gtgcgaggaggtattgccagtgccgtcatctctatccccaaccgctatatgcattcgccg
aacgagatgattgcattgcacgacgtggagtgcgcagtgcgcctgatcgccgcttttgtg
cattcagtcagtaatgtgaacgaatttattccacaagatgaataa

DBGET integrated database retrieval system