KEGG   Chloroflexus aurantiacus: Caur_1873Help
Entry
Caur_1873         CDS       T00639                                 

Definition
(RefSeq) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cau00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Caur_1873
Enzymes [BR:cau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Caur_1873
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Caur_1873
DNA repair and recombination proteins [BR:cau03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Caur_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA Zn_ribbon_SprT zinc-ribbons_6 OrfB_Zn_ribbon Zn-ribbon_8 Zn_Tnp_IS1595
Motif
Other DBs
NCBI-GeneID: 5826323
NCBI-ProteinID: YP_001635478
UniProt: A9WDC2
Position
2568315..2569151
Genome map
AA seq 278 aa AA seqDB search
MPELPEVETVARSLAPQLQGRTITGLAKLDWPKMLTPSPDEFAALIAGRRIEAIGRRAKW
LLLSLDGEWTLAIHLRMSGQLLVAEPETSEARHVHFALDLDNGRRLIFNDQRKFGRVHLL
DRQGLAALDAVHGPEPLAADFTPSALAERLQNRRAPIKALLLDQHLIAGIGNIYANEALW
LARIHPLTPGAMLTPEQINELHHAIRHVLQEAITNQGSSLRNYRDGYGRQGTQQEHFNVY
DRAGEPCPRCQSTIERIVVAQRSTYFCPTCQITMQQPE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgccggaacttcctgaagttgaaactgttgcccgctccctcgccccgcagcttcaggga
cgcacaattaccgggctggccaaacttgactggccaaaaatgctgacaccgtcacctgat
gaattcgccgcactgattgccggacggcgcatcgaggcgattgggcggcgagcaaagtgg
ctgctgctgtcgctcgatggtgagtggactctggccattcatctgcgcatgtcgggacaa
ttgctggttgccgaaccggagacatctgaggcacggcacgtccattttgccctcgatctc
gacaacgggcggcgactcatcttcaacgatcagcggaagtttggccgcgtccacctgctc
gaccggcaagggctggccgctctggatgcagtccacggcccagaaccgctcgccgctgat
tttactccctctgcattagccgaacgcctgcaaaaccgccgggcaccgatcaaagctttg
ctgctcgatcaacacctgatcgccggcattggcaacatctacgccaatgaagcgctctgg
ctggcccgcattcacccgctgactccaggcgcaatgcttacgccggaacagatcaacgaa
ctacaccatgccatccggcacgtgctgcaggaagctatcaccaaccagggcagttcgttg
cgcaactaccgtgacggttatggccgacagggtacgcaacaagagcattttaatgtctac
gaccgggccggtgagccgtgcccgcgctgtcagagcacgattgaacggattgtggtcgct
cagcggagcacctatttctgtccgacctgtcagattaccatgcaacaaccggaataa

DBGET integrated database retrieval system