KEGG   Chloroflexus aurantiacus: Caur_1947Help
Entry
Caur_1947         CDS       T00639                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caur_1947
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caur_1947
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caur_1947
Enzymes [BR:cau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caur_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2675713..2677041
Genome map
AA seq 442 aa AA seqDB search
MYHAWFAAQDDPNERYPLTEVVYYSRSGGLLEVQHDMAALAQRSPEEWKRLFDERWMRTA
WPYGSGVWGKKEWVCPIVSDDNVVSMFEGGTNLFWAERFGREIGLEDLWIKMCGNSHTGS
FKDLGMTVLVSVVKQMISEGKPIRAIACASTGDTSAALAAYGAAAGIPTIVFLPKGKVSI
AQLVQPVAHGALVLALDTDFDGCMRIVREITANPDNGIYLANSLNSLRVEGQKTVGIEIV
QQFDWEVPDWIIIPGGNLGNTFALGKGLLMMHELGLIDRLPRIVTAQAANANPLYRSYLT
GFREYEPIKAQPTAASAIQIGDPVSINRAISILKRFNGIVEQATEQELADAAARADRTGA
YACPHTGVALAALIKLVERGEIKRSDRVVVISTAHGLKFSRFKVEYHEGTLRDVVGQYTN
PPIELPPDVDAVRRAIAQRFGD
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgcatggtttgctgcccaggatgacccaaacgaacgttatcctctgaccgag
gtcgtgtactacagccggtcgggaggcttactcgaagtacagcatgatatggcagcgttg
gcccaacgcagcccggaagaatggaagcgcctgtttgatgagcgctggatgcggacagcc
tggccctatggtagtggggtgtgggggaagaaagagtgggtctgcccgattgtatctgac
gacaacgtggtcagtatgtttgagggtggaaccaacctgttttgggccgagcgtttcggg
cgtgaaatcgggctggaagacctctggatcaagatgtgtggcaattctcacaccggttcg
ttcaaagatctcggtatgacagtgctggttagtgtggtcaagcagatgatcagcgagggc
aagccgatccgggcaatcgcctgcgcctcaaccggcgatacgtctgcggcactggcggcc
tacggagcagcagccggcattcctaccattgtcttcctgccgaaagggaaggtaagtatc
gctcaactggtacaaccggtggcccacggtgcgctggtactggcgcttgataccgatttt
gatggctgtatgcggatcgtgcgcgagattactgccaatcccgacaacggtatctacctt
gccaattcgctcaattcactgcgggtcgaagggcagaagacggttgggatcgagattgta
cagcaatttgactgggaagtgccagactggatcatcattccgggtggcaatctaggcaac
acctttgctctgggcaagggtttgttgatgatgcacgaactgggcctgattgatcgactg
ccacggatcgtcacggcgcaggccgccaatgccaacccactctaccgctcgtacctaacc
ggttttcgcgagtatgagccgattaaggctcagcctactgccgccagtgcaattcagatt
ggcgatccggtaagcatcaatcgcgcaatcagcattctcaaacgcttcaacggcatcgtc
gaacaggcgaccgaacaggagctggccgatgctgcggctcgcgctgatcgaactggcgct
tacgcctgtccacatactggggtcgcgctggcagccctgatcaaactggtggaacggggt
gagatcaagcgaagtgatcgggttgttgtcatctcaactgctcacggcctcaagttcagc
cgcttcaaagtagagtatcatgaaggtacgctccgcgatgttgtcgggcagtacaccaat
cccccaatagaattaccgcctgacgtggacgcggtgcgccgggcaattgcccagcggttt
ggagattga

DBGET integrated database retrieval system