KEGG   Chloroflexus aurantiacus: Caur_1947Help
Entry
Caur_1947         CDS       T00639                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00260  Glycine, serine and threonine metabolism
cau00750  Vitamin B6 metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01230  Biosynthesis of amino acids
Module
cau_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caur_1947
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caur_1947
Enzymes [BR:cau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caur_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3439 ACP_syn_III_C
Motif
Other DBs
NCBI-GeneID: 5826398
NCBI-ProteinID: YP_001635551
UniProt: A9WE03
Position
2675713..2677041
Genome map
AA seq 442 aa AA seqDB search
MYHAWFAAQDDPNERYPLTEVVYYSRSGGLLEVQHDMAALAQRSPEEWKRLFDERWMRTA
WPYGSGVWGKKEWVCPIVSDDNVVSMFEGGTNLFWAERFGREIGLEDLWIKMCGNSHTGS
FKDLGMTVLVSVVKQMISEGKPIRAIACASTGDTSAALAAYGAAAGIPTIVFLPKGKVSI
AQLVQPVAHGALVLALDTDFDGCMRIVREITANPDNGIYLANSLNSLRVEGQKTVGIEIV
QQFDWEVPDWIIIPGGNLGNTFALGKGLLMMHELGLIDRLPRIVTAQAANANPLYRSYLT
GFREYEPIKAQPTAASAIQIGDPVSINRAISILKRFNGIVEQATEQELADAAARADRTGA
YACPHTGVALAALIKLVERGEIKRSDRVVVISTAHGLKFSRFKVEYHEGTLRDVVGQYTN
PPIELPPDVDAVRRAIAQRFGD
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgcatggtttgctgcccaggatgacccaaacgaacgttatcctctgaccgag
gtcgtgtactacagccggtcgggaggcttactcgaagtacagcatgatatggcagcgttg
gcccaacgcagcccggaagaatggaagcgcctgtttgatgagcgctggatgcggacagcc
tggccctatggtagtggggtgtgggggaagaaagagtgggtctgcccgattgtatctgac
gacaacgtggtcagtatgtttgagggtggaaccaacctgttttgggccgagcgtttcggg
cgtgaaatcgggctggaagacctctggatcaagatgtgtggcaattctcacaccggttcg
ttcaaagatctcggtatgacagtgctggttagtgtggtcaagcagatgatcagcgagggc
aagccgatccgggcaatcgcctgcgcctcaaccggcgatacgtctgcggcactggcggcc
tacggagcagcagccggcattcctaccattgtcttcctgccgaaagggaaggtaagtatc
gctcaactggtacaaccggtggcccacggtgcgctggtactggcgcttgataccgatttt
gatggctgtatgcggatcgtgcgcgagattactgccaatcccgacaacggtatctacctt
gccaattcgctcaattcactgcgggtcgaagggcagaagacggttgggatcgagattgta
cagcaatttgactgggaagtgccagactggatcatcattccgggtggcaatctaggcaac
acctttgctctgggcaagggtttgttgatgatgcacgaactgggcctgattgatcgactg
ccacggatcgtcacggcgcaggccgccaatgccaacccactctaccgctcgtacctaacc
ggttttcgcgagtatgagccgattaaggctcagcctactgccgccagtgcaattcagatt
ggcgatccggtaagcatcaatcgcgcaatcagcattctcaaacgcttcaacggcatcgtc
gaacaggcgaccgaacaggagctggccgatgctgcggctcgcgctgatcgaactggcgct
tacgcctgtccacatactggggtcgcgctggcagccctgatcaaactggtggaacggggt
gagatcaagcgaagtgatcgggttgttgtcatctcaactgctcacggcctcaagttcagc
cgcttcaaagtagagtatcatgaaggtacgctccgcgatgttgtcgggcagtacaccaat
cccccaatagaattaccgcctgacgtggacgcggtgcgccgggcaattgcccagcggttt
ggagattga

DBGET integrated database retrieval system