KEGG   Chloroflexus aurantiacus: Caur_1947Help
Entry
Caur_1947         CDS       T00639                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caur_1947
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Caur_1947
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Caur_1947
Enzymes [BR:cau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Caur_1947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2675713..2677041
Genome map
AA seq 442 aa AA seqDB search
MYHAWFAAQDDPNERYPLTEVVYYSRSGGLLEVQHDMAALAQRSPEEWKRLFDERWMRTA
WPYGSGVWGKKEWVCPIVSDDNVVSMFEGGTNLFWAERFGREIGLEDLWIKMCGNSHTGS
FKDLGMTVLVSVVKQMISEGKPIRAIACASTGDTSAALAAYGAAAGIPTIVFLPKGKVSI
AQLVQPVAHGALVLALDTDFDGCMRIVREITANPDNGIYLANSLNSLRVEGQKTVGIEIV
QQFDWEVPDWIIIPGGNLGNTFALGKGLLMMHELGLIDRLPRIVTAQAANANPLYRSYLT
GFREYEPIKAQPTAASAIQIGDPVSINRAISILKRFNGIVEQATEQELADAAARADRTGA
YACPHTGVALAALIKLVERGEIKRSDRVVVISTAHGLKFSRFKVEYHEGTLRDVVGQYTN
PPIELPPDVDAVRRAIAQRFGD
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgtatcacgcatggtttgctgcccaggatgacccaaacgaacgttatcctctgaccgag
gtcgtgtactacagccggtcgggaggcttactcgaagtacagcatgatatggcagcgttg
gcccaacgcagcccggaagaatggaagcgcctgtttgatgagcgctggatgcggacagcc
tggccctatggtagtggggtgtgggggaagaaagagtgggtctgcccgattgtatctgac
gacaacgtggtcagtatgtttgagggtggaaccaacctgttttgggccgagcgtttcggg
cgtgaaatcgggctggaagacctctggatcaagatgtgtggcaattctcacaccggttcg
ttcaaagatctcggtatgacagtgctggttagtgtggtcaagcagatgatcagcgagggc
aagccgatccgggcaatcgcctgcgcctcaaccggcgatacgtctgcggcactggcggcc
tacggagcagcagccggcattcctaccattgtcttcctgccgaaagggaaggtaagtatc
gctcaactggtacaaccggtggcccacggtgcgctggtactggcgcttgataccgatttt
gatggctgtatgcggatcgtgcgcgagattactgccaatcccgacaacggtatctacctt
gccaattcgctcaattcactgcgggtcgaagggcagaagacggttgggatcgagattgta
cagcaatttgactgggaagtgccagactggatcatcattccgggtggcaatctaggcaac
acctttgctctgggcaagggtttgttgatgatgcacgaactgggcctgattgatcgactg
ccacggatcgtcacggcgcaggccgccaatgccaacccactctaccgctcgtacctaacc
ggttttcgcgagtatgagccgattaaggctcagcctactgccgccagtgcaattcagatt
ggcgatccggtaagcatcaatcgcgcaatcagcattctcaaacgcttcaacggcatcgtc
gaacaggcgaccgaacaggagctggccgatgctgcggctcgcgctgatcgaactggcgct
tacgcctgtccacatactggggtcgcgctggcagccctgatcaaactggtggaacggggt
gagatcaagcgaagtgatcgggttgttgtcatctcaactgctcacggcctcaagttcagc
cgcttcaaagtagagtatcatgaaggtacgctccgcgatgttgtcgggcagtacaccaat
cccccaatagaattaccgcctgacgtggacgcggtgcgccgggcaattgcccagcggttt
ggagattga

DBGET integrated database retrieval system