KEGG   Chloroflexus aurantiacus: Caur_2309Help
Entry
Caur_2309         CDS       T00639                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cau  Chloroflexus aurantiacus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Caur_2309
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Caur_2309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3136137..3136718)
Genome map
AA seq 193 aa AA seqDB search
MTRPSDGGRIEVICGCMYSGKTEELIRRMRQVRIARQSYRIFTPRMDTRYAEGQVASHSG
SRLEAITVATMKDILAHAEDAQVVAIDELHLFDDDPAEMVRGCQWLANRGVRVIVAGLDL
NYRAEPFPAMMHLLALAEQVDKLYAICVKCGAYATRSQRLIDGKPAPADAPTIVVGGLDM
YEARCRTCYEPAV
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcccaagcgatggtggccgcatcgaggtgatttgcggctgtatgtacagcggg
aagaccgaggaactcattcggcgaatgcgtcaggtacggattgcccgccagtcgtaccgc
atcttcacaccgcgtatggatacgcgctatgccgaagggcaggtggcgagccatagcggg
agccggctcgaggcaatcacagtggcgaccatgaaggacattctggcccatgccgaggat
gcccaggttgtggccattgatgaattgcacctctttgatgatgatccggccgaaatggta
cgtgggtgtcaatggctggccaatcgcggtgtgcgagtgattgtagccggccttgatcta
aattatcgcgccgagccatttccggccatgatgcatctgctggcgctcgccgagcaggta
gacaagctatacgccatttgtgtgaagtgtggcgcctacgcaacccggtcacaacgatta
attgacggcaaaccggcacccgccgatgcgcccaccattgtggtgggagggcttgacatg
tacgaagcgcgctgccggacctgttacgagccagcggtataa

DBGET integrated database retrieval system