KEGG   Chloroflexus aurantiacus: Caur_2339Help
Entry
Caur_2339         CDS       T00639                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cau  Chloroflexus aurantiacus
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cau00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cau00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3174540..3176069)
Genome map
AA seq 509 aa AA seqDB search
MTAKTLASLLNNVAVQRLIGEPLVPVQSLTYDSRRVEPGSLFVAIRGQHSDGHQFIDQAI
ARGAVAVVVDQRYWDERPVAVPVVVVADSRVALAPLAAAFYDYPGRELTTIGITGTKGKS
TTTDVTAQLLAATGRMVGMISTVDFQIGNRRWPNDTRQSTPEAPEVQALLREMVTAGCDT
AVIEATSHALSPRWGRLVGCAFAVAVMLNIGHEHLDYHGTFEQYRADKAQLFALLGERSG
SRWAIVNADDPNHAYFLDAAPADAVRLRYGLHEPADVQGQILHSGPMSSVVRVTSPWGTT
DLTVPLPGRFNASNALAALTVALSQGVALEAAAAALAGVRAPRGRMVPIDAGQPFAVIVD
YAHNPDSFEQIFAMLRPQVQGRMIAVFGSAGERDVAKRAIQGEIAGRMCDLLVLTDEDPR
GEDREAIIAQIAAGAERAGKRPGSGYLCIPDRAQAIRAAMAAAQPGDLVLLLGKGHEGSI
IYADFSLPWNEEREARQALAELGYHRSHD
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgacggcaaaaacacttgccagtctcctgaacaatgtagctgtccaacggctaattggc
gaaccactcgtgcctgtgcaatcgctcacctacgactcgcggcgtgttgagccggggagt
ctgtttgttgccatccgtgggcagcacagtgatggtcaccagtttattgaccaggctatc
gcacggggagctgtggccgtggtggtcgatcaacggtattgggatgaacgaccggttgcc
gtgccggtagtggtggtcgccgatagccgggtggccctggcaccactggcggctgcgttc
tacgactatcccggacgtgaattgaccacaatcgggattaccggtaccaaaggaaaaagc
acaacgaccgatgtgacggcccagctcctcgctgctaccggacgtatggtgggcatgatc
agcaccgtcgattttcagattgggaatcgccgctggcctaacgatacccgtcagagcaca
ccggaagcaccagaggtgcaggcattgctgcgcgagatggtcactgccggttgcgataca
gccgttattgaagcgacatcccacgctctctcgccacgctgggggcggctggttggctgt
gcgttcgctgtggctgtaatgcttaatatcggccacgaacatctcgattaccacggcaca
ttcgagcagtatcgggccgacaaagcccagctctttgcgctacttggcgaacgcagtggt
tcgcgctgggcaattgtcaatgctgacgatccaaatcatgcgtatttccttgatgctgca
cctgccgatgcggtgcggctacggtatggtttacacgagccggcagatgtccagggacag
atactccacagtgggccgatgagcagtgtggtgcgggtaacgtcaccctggggcaccacc
gatctgaccgttccgctaccggggcgattcaacgccagtaatgcgctggccgcgctgaca
gtcgctctcagtcagggcgttgcgctcgaggcagccgctgccgccctggccggcgtgcgg
gcaccacgtggccggatggtgccaattgatgccgggcaaccattcgcggtgattgtagac
tatgctcataatcccgattcgttcgagcagatctttgccatgctgcggccccaggtgcag
gggcgaatgatcgcggttttcggcagtgccggcgagcgtgatgttgccaaacgggctatt
cagggagaaattgccggtcggatgtgtgacttgctggtgctgaccgatgaagatccacgt
ggcgaggatcgcgaggcaatcattgcccagatcgctgccggtgccgaacgggccggcaaa
cgacccggtagtgggtacctctgtattcctgatcgggcacaggccattcgggctgccatg
gccgccgcacaacccggtgacctggtgttgttgctgggcaaaggacatgagggtagcatt
atctacgccgacttttcactgccgtggaacgaagagcgcgaagcccggcaggcactggcc
gagttaggataccatcggtcgcatgattga

DBGET integrated database retrieval system