KEGG   Chloroflexus aurantiacus: Caur_2345Help
Entry
Caur_2345         CDS       T00639                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_2345
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_2345
   00052 Galactose metabolism
    Caur_2345
   00500 Starch and sucrose metabolism
    Caur_2345
   00520 Amino sugar and nucleotide sugar metabolism
    Caur_2345
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Caur_2345
   00524 Butirosin and neomycin biosynthesis
    Caur_2345
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Caur_2345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3181146..3182117)
Genome map
AA seq 323 aa AA seqDB search
MKDLPALIRERLTQNLWGVLGNQGYILGIDLGSYGLRAALVDLQHHTYQNAALESIDHED
PETTVRRVIDLARDLMAQEGVTVERLVRVGVGFSGPVDLRHGTVRLAPRRPGWENYPLQE
RFEQAFDAVTLIDNDANLIALGEATFGVGKGCQHLFYFHLSSGVGGGAVLNGRLYHGAHS
MAGEIGHAVVAHGWDGDGRPETLEELVSIGGLIRRAAAAGLAADRLEDIFSDHPIARKVV
QHTVDLMATRIAQVIALLDPEMVVLGGIVVRIGGDRFVEAIATRVNDFIAPQFARPVPVV
ASILGPDSVAIGAVAMALDSLSD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatctgcctgcccttattcgagaacggttgacgcagaacctctggggcgtcctt
gggaatcaaggctacatccttgggatcgacctgggcagttacggattacgagctgcattg
gtcgacttgcagcaccacacctaccagaatgccgctctcgagtcgattgatcatgaagac
ccagagacaacggtacgccgggttatcgatctggcgcgagatttgatggcgcaggaaggt
gttaccgtcgagcgcctggtacgggttggcgtaggctttagcggcccggttgacctccgc
catggcacggtacggctggccccacggcgaccggggtgggaaaattaccccttgcaagag
cgtttcgagcaggcgtttgatgccgtgacgctcattgacaacgatgcgaatctgatcgcc
ctgggagaggcaacctttggtgtcggcaaaggatgccagcatctattttactttcacctg
agcagtggcgttggcgggggcgcagtgctgaacggtcgcctgtaccatggcgcccactca
atggccggcgaaatcgggcatgcagtggttgcccacggctgggatggcgatggtcgcccg
gagaccctggaagagctggtttcgataggaggattaatccgccgggcagccgccgcaggg
cttgccgcggatcgactggaagatatttttagcgatcatccgattgcccgcaaggtagta
cagcataccgttgatctcatggccacccggattgcgcaagtgattgcactgctcgatcca
gagatggttgtcctgggaggaatcgttgtgcggatcggtggtgatcgcttcgtggaagcg
attgcgaccagagtgaacgacttcatcgccccacagttcgcccgtcccgtaccggtggta
gcgtcaatccttggccccgatagcgtcgcaattggcgctgtcgcgatggcactcgatagc
ctgtcggattga

DBGET integrated database retrieval system