KEGG   Chloroflexus aurantiacus: Caur_2536Help
Entry
Caur_2536         CDS       T00639                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Caur_2536
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Caur_2536
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Caur_2536
Enzymes [BR:cau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Caur_2536
Exosome [BR:cau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Caur_2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3379195..3380769
Genome map
AA seq 524 aa AA seqDB search
MLNKKRVLGLIVTLALLVATVSVTVAGTGIPELRRSSPTGNVIFLHPDGAGLNHWAAARI
YWYGPDALSPWDTLPQMAAYRGHMADILTGTSNGGATTHAFGYKVEGLGSFGKDGDGDSA
RSILALSGYPGSIVREAINNGHPVALVNDGDIAEPGTGAFVSEVGNRNEDNEIVGQIIDG
RPGFEGEHPPHIILAGGERFFLPQGTPPCTPDNINLDCYVHTDPITGAGPARTDGRNLLR
EFEAKGYVIVRTRAEFEALRERVNSDRRYAPYVLGLFAADDIFNDVPEERLIAAGLVDPA
IDVNDKRTNLILFGSAPGTLGYNPPTVAEMADLALTIIQRCARQAGKPFIMVAEVESVDN
FGNNDNAIGTLTGLKHANDLIQVTQNFQQRHRRTLILTAADSDAGGMQVGAWDPTRNVSD
YNNNPTGNSAQNVRSPLDGRYGRNSPPFLSEPDAYGNRMAFAVSWVGTPDVSGGIISRAQ
GLNAIEMSRTFSGRFDNTDVYRLMYLTLFGRGLPSSVGQTAPSR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaagaaacgagtcctcggcctgattgtcaccctcgccctactggtggcaacg
gtttcagtgactgttgccggaacgggaattcccgaattacgccgttcctcaccgaccggt
aatgtgatcttccttcaccccgatggggcgggtttgaatcactgggcggctgcacgtatc
tactggtacggtcctgacgccctcagcccgtgggatacgctgccgcaaatggccgcctac
cgcggtcacatggcggatattttgaccgggacatcgaacggtggcgctaccacgcacgcc
tttggttacaaggttgaaggacttggttctttcggtaaagatggtgatggtgatagcgcc
cgcagtattcttgccctctctggctacccgggtagcattgtacgtgaggctattaacaat
ggccatcctgttgccctggtcaacgacggcgatatagccgaaccaggtactggtgcgttt
gtttctgaagtcggtaaccgtaacgaggacaacgagattgttggccagataattgatggc
cggcccggttttgagggtgagcatccgccacacatcattctggccggtggtgaacgcttc
ttcttaccgcaaggtacgccaccctgcacgcccgacaacattaatctggattgctacgtt
cacaccgatccgatcaccggtgccgggcctgctcgtaccgatggtcggaatctgttgcgt
gagtttgaagcaaagggctacgtgatcgtccgtactcgtgccgagtttgaagccctgcgt
gagcgggtcaacagtgatcgtcgctacgcaccatacgtgttgggtctcttcgctgccgac
gacatctttaacgatgtgccggaagagcgtctgattgccgccggtctggtcgatcctgcg
attgacgtcaatgataagcggaccaatctcatccttttcggcagcgctcccggtacatta
gggtacaatccgccgactgttgccgagatggccgatctggcgcttacgatcatacaacgc
tgtgcccggcaggccggtaagcccttcattatggttgccgaggtggagagtgtcgataac
tttgggaacaacgacaacgcgattggtacgctgaccggtctgaagcatgccaacgacctg
atccaggttacgcaaaacttccaacagcggcatcgacgaacgctgattctgaccgcagcc
gacagcgatgctggtggtatgcaagttggggcctgggatccaacccgcaacgtcagcgat
tacaataacaatcccacaggcaacagtgcgcagaatgtgcgatcaccgcttgatggccgc
tatggccgcaactcgcctccattcctgagtgagcctgacgcttacggcaatcgtatggca
ttcgccgtaagctgggttggcacgcctgatgtgtcgggtggcattatctctcgtgcgcag
ggtttgaacgcaattgagatgtcgcgcacgtttagcggacggttcgacaatactgacgtg
tatcggttgatgtatctgacgctgtttggtcggggattgccatcatctgttggtcagaca
gctccgtctcgctag

DBGET integrated database retrieval system