KEGG   Chloroflexus aurantiacus: Caur_2591Help
Entry
Caur_2591         CDS       T00639                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cau00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3452941..3456678
Genome map
AA seq 1245 aa AA seqDB search
MHVVVLTIDGNHRPALLVAAERLRRDHKVDLSLAIYDAATLSNAAGWAKLDRDLARADLV
FGARLFSEDLVRPLVERLAHFERPTLIITSNPALIRCTRIGGFSLRRESENEPGPLRRWV
QKLRPQGGAGEARRQLAILRNLSKVLKVIPGTSRDLYTYITSHQYWLNASPENLYRLLCV
LIGRYGPSPRPKLPQLDPLTYPDTAIYHPDAPDLFTSLNDYYRWRGKRIPSAGKVGILTL
RTVVLSGNTPHIDALARAIEARGLEARVAYAAGLDLRPLLDKELADVDLLVNATGFALVG
GPAESQPQQAAEALTRFDRPYLSLVPLAFQRIDDWRADDNGLVPVQQALSVAIPELEGAA
EPLIFGGPAADGQRFAPAQAEIEQIADRIARRVALRRMPNAQKRLAVVIYNFPPALGTVG
TAAYLDVFASLFRLLQALAADGYQVEVPESVDALRQLLLADGPAHGADAHIADWLSADEY
RRLFPAYTDIEPYWGPAPGDLLRDNRGIRILGRQFGNVFVGVQPSFGYERDPMRLLLAKD
AAPNHAFAAFYTWLIHKFRADAVIHLGTHGAMEFMPGKQVGLSARCWPLRLIGPLPNFYV
YSVNNPSEAAIAKRRGAATLVSYLVPPVQQAGLYKGLRTLRDAIDQFERHPDPALVSDVR
ERAAQLGIPMAASGDDYADVAGLAHELLRIEQRMIPLGLHVLGQPPAPAELADFLLLYAS
LQPDGGLPALIARGMGIDYADLCTRLHSDLAAQSQLRLIEERGRAAMLAYAEAPDAETGA
RAASTALADLVPATALRPLWPKLAELRTGLLTNHELRNLLHGLRGGFIPPSPSNDAVRNP
AVLPTGRNLFALDPYRVPTPASMQRGEALATELIERLRREQGQFPSSIAIVLWGTDNLKS
DCEAVAQVLALIGARPVIDELGNVSDVALRPLAELGRPRIDVVVTVSGIFRDLLSHQMRL
IDRAAYLAATADEPPEWNFVRAHALAQVAETGVSLAEAAIRVFANAPGSYGANVNFLVES
GTWENDDQLSDAFLSRKSFVRTADGQWREARSLLEGALRHVQATFQNIDSFEVGLTDIDN
YYENLGGMAKSVARLRGEPPPVLVADAISSPGASRVASIETMLRLETRAKLLNPKWHEAM
LAHGFAGVREIEARVGHTYGWSATANAVEDWVYDEIAATYALDDAMRERMAALNPTATAG
VVRRLLEAAGRGFWAADEATLNRLQEIYQDLEDRLEGITEERSVG
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atgcacgttgtggtgttaaccatcgacggtaatcatcgtccggcgctgttggtggctgcc
gagcggctgcgccgcgatcataaggttgatctgagcttggctatctacgatgcggcaacg
ttgagtaatgccgcaggatgggcgaaactcgaccgcgatctggcaagggccgatctggtg
ttcggggcacgcctgttcagcgaagacctggtgcggccactggtcgaacgattggcccat
tttgaacgaccaacgctgattattacctcaaatccggcactgatccgttgtacccggatc
ggtggcttttcgttgcggcgcgaaagcgagaacgaaccggggccacttcgtcgttgggtg
cagaagctccgaccgcagggtggtgcaggcgaggcccggcgtcaattggcgattttgcgc
aatttaagtaaggtgttgaaagttatccccggcacgtcccgcgatttgtacacctacatt
accagtcatcaatactggctgaatgcctcgccagagaatctctaccgcctgctttgcgtg
ctcatcggtcgttatggcccatcgccgcgcccaaagctgccacagcttgacccactaacc
tatcccgatacggcgatctaccaccccgacgcgcccgatctctttacgtcgttgaacgat
tactaccgctggcgtggaaaacgcataccgtctgcgggtaaggttggtattctgaccctg
cggacggtggtgttgagtgggaataccccgcatattgatgcattggcccgcgctattgag
gcgcgcgggctggaagcccgtgtcgcctacgctgccgggcttgatttgcgtccgctgctc
gataaggagctggccgatgtcgacctgctggtcaatgcaaccgggtttgctctggttggt
ggcccagccgagagccagcctcagcaggctgccgaggcattaactcgcttcgaccgtcca
tacctcagtctggtaccgctggcgtttcaacgaatcgacgactggcgcgccgatgataac
ggtctggtgccggtgcagcaggcgctgagtgtcgccattcccgaactggaaggtgctgcc
gaaccgctgatctttggcgggccggcggctgatggtcagcgctttgccccagcccaggcg
gaaatcgagcagattgccgaccggattgcgcgccgggtggccctacgtcggatgccgaac
gcgcagaagcggctggcggtggtgatctacaactttcccccggccctgggcacggttggc
actgccgcctatctcgatgtctttgccagtctgtttcgtctgttacaggcgctggctgcc
gacggctatcaggttgaggtgccggaaagcgttgatgcgttacgccagcttctgttggcc
gatggaccggcccacggtgccgatgcgcacatcgccgattggctcagcgcggacgagtat
cgccggctcttcccggcgtataccgacatcgagccgtactggggaccggcaccgggtgat
ctgctgcgcgacaatcgtgggattcggattctcggtcgtcagtttggaaatgtctttgtc
ggggtacagcccagttttggctacgagcgcgacccaatgcggttgttgctggcgaaagat
gctgccccgaatcatgcctttgccgcattctacacctggctgatccacaaattccgcgcc
gatgctgtcattcatcttggcacacacggcgcaatggagtttatgccgggcaagcaggtt
gggttgagtgcccgctgctggccgctgcgcctgatcgggccgttgcccaatttctacgtc
tacagtgtgaacaatccgagcgaggcggcgattgcaaagcggcgcggcgcggccacactg
gtgagctatctggtaccaccggtgcaacaggcagggctgtacaaagggctgcggacgctg
cgcgatgcaattgatcagtttgaacgccatcccgatcctgccctggtgagcgatgtgcgc
gagcgggcagcgcaattaggcattccaatggcggccagtggtgatgattacgctgatgtt
gccggtctggctcacgagctactgcggatcgagcagcgcatgatccctctcggcctgcac
gtcctcggccaacccccggcaccggctgagctggccgactttctcctgctctacgccagt
ttacaaccagatggtggtttgcccgctttgattgcccgtgggatgggaattgattacgct
gatttatgcacgcgcctacatagcgatctggcggcccaaagccagcttcggttgatcgaa
gagcgaggaagggcggcgatgctggcctatgccgaagcccctgatgccgagactggcgcg
cgtgcggcatccactgcacttgccgatctggtgccggcaaccgcacttcgccccctctgg
ccgaaactggctgaattgcgtaccggtctgttgaccaatcacgagctacggaatctgttg
cacggtctgcgtggtggctttatccctccctccccgagcaatgatgcagtccgcaatccg
gcagtgctgccgaccggacggaatctgtttgcactcgatccctaccgggtgcctacgccg
gcctcaatgcagcgtggtgaagcgctggccactgaactgatcgagcgcttgcgtcgtgag
cagggccagtttccttccagcatcgcgattgtgttgtggggtaccgacaatctcaagagc
gattgtgaagctgtcgcgcaggtgctggcgctgatcggcgcccgtccggtcatcgatgaa
ctgggcaatgtgtccgatgtcgcgctgcgcccactcgccgagctaggccgcccccggatc
gacgtggtggtgacggtgagcggtatcttccgcgatctgctcagccatcagatgcgcctg
attgatcgggcggcgtatctggcggcaactgccgatgagccgccagagtggaattttgtg
cgggcgcatgcgctcgcccaggtggccgagactggcgtctcgttagccgaagcggccatt
cgcgtcttcgccaatgcgcctggaagctacggagcgaatgtcaacttcctggtcgagagt
ggtacctgggagaacgacgaccagctcagcgacgcctttctatcacgcaaaagctttgtt
cgtactgctgatgggcaatggcgggaagcccgtagcttgcttgaaggcgcgttgcgtcac
gttcaggccacattccagaacatcgacagctttgaggtgggtctcacggatattgacaac
tactacgaaaacctgggcgggatggcaaagagtgttgccaggttgcgtggcgaaccgccg
ccggtactggttgccgatgcgatcagctcacccggcgccagtcgcgtggcctcgattgaa
acgatgctgcgccttgaaacgcgggcgaaattgctcaatccgaagtggcacgaagccatg
ctcgcccacggctttgccggtgtgcgcgagatagaggcgcgtgttggtcatacctatggc
tggagtgcaacagcgaatgcggtagaagactgggtgtacgacgaaattgcagccacctac
gcactcgacgacgcgatgcgtgaacggatggccgccctcaatccaactgcgaccgccggg
gttgttcggcgtctgctcgaagctgccggacgtggcttctgggctgccgatgaagcaacc
ctcaaccgcctgcaggaaatctatcaggacctcgaagatcgactggaaggcattaccgaa
gagaggagtgtaggatga

DBGET integrated database retrieval system