KEGG   Chloroflexus aurantiacus: Caur_2595Help
Entry
Caur_2595         CDS       T00639                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cau  Chloroflexus aurantiacus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Caur_2595
Enzymes [BR:cau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Caur_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3460438..3461190
Genome map
AA seq 250 aa AA seqDB search
MSGLVGRRIAITRPAGRGDTLAARLQALGAIPLLTPLIAYMPPPDPAPLQQALNRLATGA
YHWLVVTSRQTVQVLADTTIPESTAIAAVGKATASDCRRAWGREPTVVPDTEIGSALPAI
MGQLAGKRVLLPCADIAPPTLTEALRAAGADVDRVTAYCTVAGPGLADLQRMIDDGAIDA
IVLASGSAVRQLQQLHVPTGLPPLVCIGPSTAAVCADLGLPIAGIAERPNDDALIAVLEQ
VFTPYCEVKE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagtggactggttggtcgtcgaatcgccatcacgcgcccggccggacgtggcgatacg
ctggctgcacgcttgcaggcgcttggtgcgattccacttctgacgccactgattgcctat
atgccgcctcccgatccggcaccattgcagcaggcgctcaatcgtctggctactggtgcg
tatcactggctggtcgtgaccagccggcagacggtgcaggtgttagctgacaccacaatt
cctgaatcgaccgccattgcagcggttggcaaagcgactgccagcgattgtcggcgggcc
tgggggcgcgaacctacagttgttcctgataccgagatcggcagtgccttgccggcgatc
atggggcagcttgccgggaagcgtgtcttgttgccctgcgcggatattgctccgccaact
ctcactgaagcgcttcgcgctgccggtgccgacgttgatcgggttaccgcctattgcacc
gtggccggccctggccttgccgatttgcaacgtatgatcgatgacggtgcgattgacgct
atcgtgctcgccagtggttcggcagttcgccagttgcagcagcttcacgtaccgaccggc
ttgccgccactggtctgcattggccccagcacggctgccgtttgcgctgatctagggctc
cccattgcgggtattgccgaacgtccaaacgacgatgcgctgattgctgtgcttgaacag
gtttttacaccgtattgtgaagtgaaggagtaa

DBGET integrated database retrieval system