KEGG   Chloroflexus aurantiacus: Caur_2694Help
Entry
Caur_2694         CDS       T00639                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cau  Chloroflexus aurantiacus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caur_2694
  Amino acid metabolism
   00340 Histidine metabolism
    Caur_2694
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Caur_2694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3604486..3605793
Genome map
AA seq 435 aa AA seqDB search
MTVPIIRDIDTARAGILRRMPLDDDAATTTAVAGIIAGVRQRGDAALREYTQRFDGVDRA
TLEIPRERWAAAAADLDPALRHALLLAIGEIRRFHERQLRNSWVEFSVEGALGQLVRPLD
RVGLYVPGGAAPLPSSLIHAAVPARVAGVREIVVCSPPQRSTGEPAEVVMAAAHLAGVDR
LFAVGGAQAIAALAYGTESVPRVETIAGPGNRYVIQAMRLVYGTVGIVSLPGPTETLIIA
DHTASPRAVAADLLAQAEHVEASAILLTPDPVLAEQVQVEVERQLATLPSPNAQAARDAV
TRRGGIVIVPDLATAFMLANDYGPEHLCLLVADPWSYVGMVRNAGGIFLGEESFEVLGDY
VAGPSHIMPTEGTARYASPVNVDSFRKIISLVGLNRSGLNRIGPAAMRLAEAEGLVAHAA
AVKVRFESADTDGRE
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacggttcctatcatccgcgacattgatactgcccgtgccggtattctgcggcgtatg
ccactcgatgacgatgctgcgacgactactgccgttgccgggattattgctggcgtgcgc
caacggggcgatgccgcattacgcgagtatacgcaacgcttcgatggggtagatcgggca
acgcttgaaattccgcgtgagcggtgggctgcggcggcagccgatcttgatccggcgtta
cgtcatgccctcttgctggcaatcggcgagattcggcgttttcatgaacggcaactgcgc
aactcctgggttgaatttagcgtcgaaggagcactggggcagttggtgcggcccctggat
cgagttgggctttacgttcccggtggagcagccccgctcccgtcatcgttgatccacgct
gcggtacccgcacgggtcgccggtgtgcgcgagattgtggtctgctcgccaccacaacgc
tcgaccggtgaaccggctgaggtggtgatggcagcggcgcatctggccggagttgatcgc
ttgtttgcggttggtggcgcccaggccattgccgcgctggcctatggcaccgagagcgtt
ccacgggtggagacgatagccgggccagggaatcggtatgtcattcaggcgatgcgcctg
gtgtacggtacggtaggaatcgtcagtctgccagggccaaccgagaccctgatcatcgcc
gatcacacagccagcccgcgggcggttgcggctgatctgctggcacaggccgaacatgtc
gaggcaagtgccattttattgacccctgatccggtgctggccgaacaggtgcaggttgaa
gtcgaacgacagcttgccacattaccgtcaccaaatgcacaggctgcccgtgacgcagtg
acccggcgtggtggcatcgtgattgtgcccgacctggcaacagccttcatgctggccaat
gactacgggccagagcatctctgcctgttggtcgccgacccgtggtcgtatgtcggaatg
gtgcgcaacgcaggcggtattttcctgggcgaagagtcgtttgaagtactgggtgattat
gttgccgggccatcacacatcatgccaaccgagggcacggcgcgctatgcttcaccggtc
aacgttgatagttttcgcaagatcatctcgctggttggcctgaatcgaagtggtctcaat
cggattgggccagcagcgatgcggttagcagaagcagagggtctcgttgcgcacgctgct
gccgtcaaagttcgcttcgagtcggcagataccgatgggagggagtag

DBGET integrated database retrieval system