KEGG   Chloroflexus aurantiacus: Caur_2939Help
Entry
Caur_2939         CDS       T00639                                 

Definition
(RefSeq) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00220  Arginine biosynthesis
cau00330  Arginine and proline metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01130  Biosynthesis of antibiotics
cau01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Caur_2939
   00330 Arginine and proline metabolism
    Caur_2939
Enzymes [BR:cau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Caur_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5827411
NCBI-ProteinID: YP_001636527
UniProt: A9WFY4
Position
3946037..3946945
Genome map
AA seq 302 aa AA seqDB search
MSSGSQIAILGVPIDLGAGRRGVDMGPSAIRYAGLSRRLGELGYQVVDFGNLTVPMVETT
PPPPPDSRLRYLEPIADMCGRLARQVADIVQQGMLPLILGGDHSLTIGSASGSARQRRLG
LIWIDAHADFNDEHTTPSGNIHGMPLAVLTGRGHPTLTGFAGRIPAFDPAHVVLIAVRDL
DPLEREALRASPITVFTMHEIDRCGMATVMERALAIATTGTEGFHLSFDLDVVDPREAPG
VGTPVSSGISARESHLAMELIAESGALRSLDVVEVNPILDERNATAQLAVDLVLSALGKR
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtggatcacagattgcaattctcggcgttcccatcgatcttggagccggacgg
cgtggcgtcgatatggggccgagtgccattcgctacgccggtctgagccgaagactgggc
gagttgggctatcaggtggttgatttcggcaatctgacggtgccgatggtcgagacgacc
ccaccgccaccacctgattcacgcctgcgctatcttgagccgattgccgatatgtgtggg
cggctggcccggcaggtggccgatattgtccagcaggggatgctgcccctcattctgggt
ggtgaccatagtttaactatcggttccgccagtgggagtgcgcggcagcgacgacttggt
ctgatctggattgatgcccacgccgattttaacgatgaacacacgacaccgagtggcaat
attcacggcatgccgctggctgtgttaaccggacgcgggcatccgacgctcaccggtttt
gccggtcgcataccggctttcgatccggcgcacgtcgtattgattgccgtgcgcgatctc
gatccgctggagcgggaagcattgcgcgcttcgccgatcaccgtctttaccatgcacgag
attgatcgctgtgggatggcaacggtgatggagcgggcgctggcaattgccacgaccggt
actgaaggatttcatctcagttttgatctcgatgttgtcgatccgcgcgaggcgcccggt
gtgggtacaccggtaagcagtgggatttcggctcgcgaatcacatctggcgatggaactg
atcgccgagagtggtgcgctgcgtagtctggatgtggtcgaagttaatccgatcctcgat
gagcgtaacgcgactgcgcagttggccgtcgatctggttttgtcagcgttaggtaaacgt
attttgtag

DBGET integrated database retrieval system