KEGG   Chloroflexus aurantiacus: Caur_2939Help
Entry
Caur_2939         CDS       T00639                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caur_2939
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Caur_2939
Enzymes [BR:cau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Caur_2939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3946037..3946945
Genome map
AA seq 302 aa AA seqDB search
MSSGSQIAILGVPIDLGAGRRGVDMGPSAIRYAGLSRRLGELGYQVVDFGNLTVPMVETT
PPPPPDSRLRYLEPIADMCGRLARQVADIVQQGMLPLILGGDHSLTIGSASGSARQRRLG
LIWIDAHADFNDEHTTPSGNIHGMPLAVLTGRGHPTLTGFAGRIPAFDPAHVVLIAVRDL
DPLEREALRASPITVFTMHEIDRCGMATVMERALAIATTGTEGFHLSFDLDVVDPREAPG
VGTPVSSGISARESHLAMELIAESGALRSLDVVEVNPILDERNATAQLAVDLVLSALGKR
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtggatcacagattgcaattctcggcgttcccatcgatcttggagccggacgg
cgtggcgtcgatatggggccgagtgccattcgctacgccggtctgagccgaagactgggc
gagttgggctatcaggtggttgatttcggcaatctgacggtgccgatggtcgagacgacc
ccaccgccaccacctgattcacgcctgcgctatcttgagccgattgccgatatgtgtggg
cggctggcccggcaggtggccgatattgtccagcaggggatgctgcccctcattctgggt
ggtgaccatagtttaactatcggttccgccagtgggagtgcgcggcagcgacgacttggt
ctgatctggattgatgcccacgccgattttaacgatgaacacacgacaccgagtggcaat
attcacggcatgccgctggctgtgttaaccggacgcgggcatccgacgctcaccggtttt
gccggtcgcataccggctttcgatccggcgcacgtcgtattgattgccgtgcgcgatctc
gatccgctggagcgggaagcattgcgcgcttcgccgatcaccgtctttaccatgcacgag
attgatcgctgtgggatggcaacggtgatggagcgggcgctggcaattgccacgaccggt
actgaaggatttcatctcagttttgatctcgatgttgtcgatccgcgcgaggcgcccggt
gtgggtacaccggtaagcagtgggatttcggctcgcgaatcacatctggcgatggaactg
atcgccgagagtggtgcgctgcgtagtctggatgtggtcgaagttaatccgatcctcgat
gagcgtaacgcgactgcgcagttggccgtcgatctggttttgtcagcgttaggtaaacgt
attttgtag

DBGET integrated database retrieval system