KEGG   Chloroflexus aurantiacus: Caur_2969Help
Entry
Caur_2969         CDS       T00639                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cau  Chloroflexus aurantiacus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_2969
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Caur_2969
   00630 Glyoxylate and dicarboxylate metabolism
    Caur_2969
Enzymes [BR:cau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Caur_2969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4000295..4001893)
Genome map
AA seq 532 aa AA seqDB search
MTTSRLPAGVTITAPITPAYAEILTPEALEFLATLHRRFNTRRLELLARRAERQRAIDAG
ERPDFLPETAHIRESEWTIAPIPPQIQDRRVEITGPVDRKMIINALNSGAKVFMADFEDA
NTPTWQNQVEGQINLRDALRRTITYTSPEGKHYALNNNPAILFVRPRGWHLNEKHMLVDG
EPISGAIFDFGLYFFHNAQTAIDVQGGPYFYLPKMESHLEARLWNDIFVLAQELRGIPQG
TIKATVLIETILAAFEMDEILYELRNHSAGLNCGRWDYIFSCIKKFRNDPNFCLADRALV
TMTTHFMRSYSLLAIKTCHRRGAHAMGGMAAQIPIKNDPVANEAALAKVRADKEREASDG
HDGTWVAHPGLVPVAMEVFDRLMPTPNQINRQRDDVQVTAADLLAFGPEKPITEQGMRLN
INVGIQYLGAWLAGNGCVPVFNLMEDAATAEISRAQIWQWIRSPKGVLEDGRKVTVELFR
QMLPEELHKVREILGPAYEDGRYEEAAELFDEITTDPEFVEFLTLPAYERIP
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctcccggttaccggctggcgtgacgattaccgcaccgattactcccgcatac
gccgagattctcactcccgaagcactggaatttctggccacactccaccgccgcttcaat
acccgtcgtctggaactgcttgcccgccgcgctgaacgtcaacgcgcaattgatgcaggc
gagcgaccggattttctgcctgagacagcccatatccgcgagagcgagtggacgattgcc
cccatcccaccccagattcaggatcggcgcgttgagattaccggcccggttgaccgtaag
atgatcatcaatgcgctcaattcaggggcaaaggtgttcatggccgattttgaagatgcc
aatacgccaacctggcagaatcaggttgaaggccagatcaacctgcgcgatgctctgcgt
cgtaccattacatataccagccctgaaggcaagcactacgccctgaacaacaatccggcc
atcctgtttgttcgcccgcggggctggcatctcaacgaaaagcatatgctggttgatggt
gagccgatctctggtgctatcttcgacttcggtctctacttcttccacaatgcccagact
gccatcgatgtgcagggtggcccctatttctacctgcccaaaatggagagccacctcgaa
gcacggttgtggaatgacatctttgtgctggcccaggagttgcgcggcattccccaggga
actatcaaggccacggtcttgatcgaaacgattctggcggcgttcgagatggacgagatt
ctctacgaactgcgcaaccactcagccggtctgaattgtggacgctgggattatatcttc
tcgtgtatcaaaaagttccgcaacgaccccaacttctgtctggccgaccgggcactggtt
acgatgactacccacttcatgcgttcatattcactgctggcgatcaagacctgtcaccgc
cgtggcgcccacgcgatgggtggtatggcggctcagattccgattaagaacgatccggtt
gccaatgaagcagcgctggcaaaagtgcgggccgacaaggagcgtgaagcctctgacggc
cacgatggcacctgggtggcccaccccggtctggttccggtggcgatggaagtgttcgac
cggctaatgccaacgccgaaccagattaaccgtcagcgtgatgatgtgcaggtaactgct
gccgatctcctggcatttgggccggaaaaaccgatcaccgagcagggtatgcgcctgaat
atcaacgttgggatccagtacctcggcgcctggctggccggcaacggctgtgttccggtc
ttcaacctgatggaagatgccgccaccgccgagatttcgcgtgcccagatctggcaatgg
attcgcagcccgaagggtgtactggaggatggtcgcaaagtgacggtggaactcttccgg
cagatgctgcctgaagagctgcacaaggttcgtgagatactcggtcccgcctacgaagac
ggtcgctacgaagaggctgccgagctgtttgacgagattacaaccgatccagagtttgtg
gaattcctgaccttaccggcttacgaacggattccgtaa

DBGET integrated database retrieval system