KEGG   Chloroflexus aurantiacus: Caur_3177Help
Entry
Caur_3177         CDS       T00639                                 

Definition
alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
cau  Chloroflexus aurantiacus
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Caur_3177
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Caur_3177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4262328..4263371
Genome map
AA seq 347 aa AA seqDB search
MRAARLHEYDEHLNVQLQLEDVPLPKITKPGDVIVRIGAAGLCRTDLHIIEGVWKDIQDP
QRTLLPYILGHENAGWVEEVGPGVTSVKVGDPVICHPLRSCGVCLGCRRGEDMYCEHGSF
PGLNCDGGFAEYMLTNERALIKLNPNVAPVDVAPLADAGITAYRVAKKAARKLNPGQYCV
ILGVGGLGHIALQSVRELCGARIIAIDRSEAARQLARNLGAHYVLDGSDTIVQEVKELTH
GGAHVVIDFVGELGAEQVSWQMLRQGGTHFVVGYGGAVHVPTVHMIITEIAIEGSLVGNY
VELVELMELNAEGRVKLHGQQYRLDQINQAIDDFKNRRIAGRAVIVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgcccgtctccacgagtacgatgaacatcttaatgtccaactgcaactcgaa
gacgtgccattgccgaagatcaccaaacccggtgacgttatcgttcgcatcggtgcagcc
ggcctgtgtcgtaccgatctgcacatcatcgaaggggtttggaaagatattcaagacccc
caacgcacgctgctcccctacatcctcggccacgagaacgcaggttgggtcgaagaggtt
gggcctggcgtgacctcagtcaaggtcggtgatccagttatttgccatccgttacgctcg
tgtggcgtctgccttggttgtcggcgcggtgaggacatgtactgcgagcacggtagtttc
cccggtctcaactgtgatggtgggttcgccgagtacatgctcaccaacgaacgggcgttg
attaagctcaatcccaacgtggctccggttgatgttgcacccctggccgatgcgggcatt
accgcctatcgggtagccaaaaaggctgcccggaaattaaatcccggccagtactgtgtt
attctcggtgttggtggattgggacatattgcactgcaatcggtacgcgaattgtgcggg
gcacgcattatcgccattgatcgttcagaggcggctcgtcagttagctcgtaatttgggg
gcgcactacgtgctcgatggcagtgataccattgtgcaagaggtgaaggagctaacgcac
ggtggcgctcacgtggtgattgacttcgtcggtgaactgggtgctgaacaggtctcgtgg
caaatgctgcgacagggcggaacccattttgtggttggctatggtggggcggttcacgtg
ccaaccgtgcacatgatcattaccgaaatagccattgaaggtagcttggtcggtaactac
gtcgagctggttgaactgatggaactgaatgccgaaggtcgggttaagcttcacggtcag
caataccggcttgatcagatcaaccaggcgattgacgatttcaagaaccgacgaattgcc
ggtagagcggtgattgtgccctag

DBGET integrated database retrieval system