KEGG   Chloroflexus aurantiacus: Caur_3196Help
Entry
Caur_3196         CDS       T00639                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_3196
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_3196
   00052 Galactose metabolism
    Caur_3196
   00500 Starch and sucrose metabolism
    Caur_3196
   00520 Amino sugar and nucleotide sugar metabolism
    Caur_3196
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Caur_3196
   00524 Butirosin and neomycin biosynthesis
    Caur_3196
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Caur_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4292776..4293756)
Genome map
AA seq 326 aa AA seqDB search
MYLAGDIGGTKTILALFDQATGPHHPVFEQTFASARYPDLETMIAEFREQHPVPIEGAAF
GVAGPVVSGRASITNLSWTIDAARLSTVLNGAPVRLLNDLEAIAQSVPILEPADLETLTA
GQAIAGGAIGVIAPGTGLGEAFLTWDGVRYRPHPSEGGHTTFAPRNQVEKDLLDYLHQRY
NHVSYERVCSGIGIPNLYAFVRDRLLQRETPAVAEQLAAASDPTPVIVQAGMATEQMCLV
CRTTLELFVDILAAEAGNLALKVLATGGVYIGGGLPPRMLPLIKRERFLQVFRDKGRFSE
LLSQVPIHVILEPKAGLLGAAAAAMS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtatctggccggtgacatcggcggcacaaagacaattctggccctctttgatcaggcg
accgggccacatcatccggtttttgaacagacatttgccagtgcgcgttatcccgattta
gagacgatgatcgctgagtttcgcgaacaacatccggttcccattgagggcgcagcgttt
ggcgtcgccgggccggtggtcagcggacgggccagtatcacgaatctgagctggacaatt
gacgctgccagattgagtacagtgttaaacggcgcaccggtacgcctgttaaacgatctg
gaagcgattgcccaatcggttccgattctcgaacctgctgatctggagacacttactgcg
gggcaagccattgctggtggcgcaattggggtcatcgcccctggtaccggtctgggtgag
gcatttctcacctgggacggggtgcgctatcgcccgcacccctctgaaggcggtcacacg
acattcgcgccccgcaatcaggttgaaaaagatctgctcgattacctgcatcaacggtac
aatcacgtcagctacgaacgtgtctgctcgggcattggcataccgaatttgtacgctttt
gtacgtgatcgactgctccaacgcgaaacgccggcggtcgccgagcaactggccgctgcc
agtgatcccacaccggtcattgtccaggccgggatggcaaccgaacagatgtgcctggta
tgccgtaccacccttgaactgttcgttgacattctggcagccgaagccggcaatctggcg
ttaaaggtactggcgaccggcggcgtatacattggcggtggtttaccaccacggatgctg
ccattgatcaagcgtgaacgattcctacaggtcttccgtgataaaggacgtttcagtgaa
ttgctgagccaggtgccgattcacgtcattctcgaaccgaaagccggtctcctcggcgcg
gcagcagcagcaatgagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system