KEGG   Chloroflexus aurantiacus: Caur_3196Help
Entry
Caur_3196         CDS       T00639                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00010  Glycolysis / Gluconeogenesis
cau00052  Galactose metabolism
cau00500  Starch and sucrose metabolism
cau00520  Amino sugar and nucleotide sugar metabolism
cau00521  Streptomycin biosynthesis
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01130  Biosynthesis of antibiotics
cau01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_3196
   00052 Galactose metabolism
    Caur_3196
   00500 Starch and sucrose metabolism
    Caur_3196
   00520 Amino sugar and nucleotide sugar metabolism
    Caur_3196
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Caur_3196
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Caur_3196
Enzymes [BR:cau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Caur_3196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-GeneID: 5824999
NCBI-ProteinID: YP_001636779
UniProt: A9WI98
Position
complement(4292776..4293756)
Genome map
AA seq 326 aa AA seqDB search
MYLAGDIGGTKTILALFDQATGPHHPVFEQTFASARYPDLETMIAEFREQHPVPIEGAAF
GVAGPVVSGRASITNLSWTIDAARLSTVLNGAPVRLLNDLEAIAQSVPILEPADLETLTA
GQAIAGGAIGVIAPGTGLGEAFLTWDGVRYRPHPSEGGHTTFAPRNQVEKDLLDYLHQRY
NHVSYERVCSGIGIPNLYAFVRDRLLQRETPAVAEQLAAASDPTPVIVQAGMATEQMCLV
CRTTLELFVDILAAEAGNLALKVLATGGVYIGGGLPPRMLPLIKRERFLQVFRDKGRFSE
LLSQVPIHVILEPKAGLLGAAAAAMS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtatctggccggtgacatcggcggcacaaagacaattctggccctctttgatcaggcg
accgggccacatcatccggtttttgaacagacatttgccagtgcgcgttatcccgattta
gagacgatgatcgctgagtttcgcgaacaacatccggttcccattgagggcgcagcgttt
ggcgtcgccgggccggtggtcagcggacgggccagtatcacgaatctgagctggacaatt
gacgctgccagattgagtacagtgttaaacggcgcaccggtacgcctgttaaacgatctg
gaagcgattgcccaatcggttccgattctcgaacctgctgatctggagacacttactgcg
gggcaagccattgctggtggcgcaattggggtcatcgcccctggtaccggtctgggtgag
gcatttctcacctgggacggggtgcgctatcgcccgcacccctctgaaggcggtcacacg
acattcgcgccccgcaatcaggttgaaaaagatctgctcgattacctgcatcaacggtac
aatcacgtcagctacgaacgtgtctgctcgggcattggcataccgaatttgtacgctttt
gtacgtgatcgactgctccaacgcgaaacgccggcggtcgccgagcaactggccgctgcc
agtgatcccacaccggtcattgtccaggccgggatggcaaccgaacagatgtgcctggta
tgccgtaccacccttgaactgttcgttgacattctggcagccgaagccggcaatctggcg
ttaaaggtactggcgaccggcggcgtatacattggcggtggtttaccaccacggatgctg
ccattgatcaagcgtgaacgattcctacaggtcttccgtgataaaggacgtttcagtgaa
ttgctgagccaggtgccgattcacgtcattctcgaaccgaaagccggtctcctcggcgcg
gcagcagcagcaatgagttga

DBGET integrated database retrieval system