KEGG   Chloroflexus aurantiacus: Caur_3329Help
Entry
Caur_3329         CDS       T00639                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cau  Chloroflexus aurantiacus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Caur_3329
  Amino acid metabolism
   00300 Lysine biosynthesis
    Caur_3329
Enzymes [BR:cau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Caur_3329
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4454069..4455157)
Genome map
AA seq 362 aa AA seqDB search
MTELRDELIRLTCDLIRFETIADRPDQLQAAIDYVADYLADVPGIQIEKSCVADKPALVV
TLQPTRSPRLMLNGHLDVVVGQPAQFVPEVRDGRIYGRGSQDMKGSIAVMMRLIRDLAQR
PNPPDVGFQFVTDEEIGGRHGTGRLRDEGWHCDFMLCLEPTDLGIMFEHKGGMWAQLRIP
GRAAHGSRPWEGDNPVYRLMQGIQAISERYPPPTGPHDWRTSVTPTEIRMGAGSRNQVPA
EALVTFDIRWTADTTPETIQADLAAAFPDAEFISVMASAGLRTDPEHQEVGRIADIVERH
IGHTPRFYREHFATDARYYSHIGIPAICLGPVGAGLHSAEEWVEIASLTSLYQIILDYID
TM
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacttcgtgatgaattgattcgtctcacctgcgacctgatccgttttgagacg
attgccgaccgtcccgatcagttacaggcggcgatagattatgtcgccgattatcttgcc
gacgttccgggcatccagatcgaaaagagctgtgtagccgacaagccggcgctggtcgtt
acgctgcaacccacgcgctcgccgcgtctgatgctcaacggacatctggatgtcgtggtt
ggacagccggcacagttcgtaccagaggtgcgtgatggccgcatctatggccgtggcagt
caggatatgaagggcagcattgccgtgatgatgcgcctgatccgcgatctggctcaacgg
cccaatccgccggatgtcggttttcaattcgtcaccgacgaagagattggtggacgccac
ggcaccggtcggttgcgcgatgaaggatggcactgcgactttatgctctgcctggaacca
accgacctggggattatgttcgagcacaaaggcgggatgtgggcacagttgcgcattccc
ggtcgagctgctcatggatcacggccctgggaaggcgataaccctgtctaccgactgatg
cagggcattcaagcgataagcgagcgctacccaccaccaactggccctcacgattggcga
acgtcggtaacaccaaccgagattcgcatgggggcaggttcgcggaatcaggtgccggca
gaggcgctggttacgtttgatattcgctggacggctgacaccacaccggagacgattcaa
gccgatctggcggcagcgtttcccgacgccgaattcatcagtgtcatggccagtgccggc
ctgcgcaccgatcccgaacaccaggaagtcgggcgcattgccgacatcgtcgaacggcat
atcggccacaccccccgtttctaccgcgaacattttgcgaccgatgcccgttactattcg
cacattggcatccctgccatctgcctcggcccggttggggccggcctgcattcggcagag
gagtgggtagagattgccagtctgacgagcctgtaccagattattctcgattatatcgac
accatgtag

DBGET integrated database retrieval system