KEGG   Chloroflexus aurantiacus: Caur_3684Help
Entry
Caur_3684         CDS       T00639                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Caur_3684
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Caur_3684
Enzymes [BR:cau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Caur_3684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4913218..4913718
Genome map
AA seq 166 aa AA seqDB search
MTIYQFSAQRIDGSTQSLADFRGQVLLIVNVASMCGLAPQYAGLEQLYRRYRDQGFTVLG
FPSNQFMQEPRNNEAIAEFCERTYQVTFPLFAKIDVNGPNEHPLFTYLKTQLPGLFGSTA
IKWNFTKFLVDRNGKPYRRYAPTDLPSQIEDDIVLLLRQQPKSLSA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgactatctatcagttctccgcacaacgaattgacggttcaacccaatcactggccgac
tttcgcggtcaggtgttgctgattgttaatgtagccagcatgtgtggtttggctcctcaa
tatgcgggtctcgaacagctttatcgtcgttatcgcgaccagggcttcacagtattgggc
tttccgagcaaccagtttatgcaggaaccacgcaataatgaagcaattgccgaattttgt
gagcgtacatatcaggtgaccttccccctctttgccaaaattgatgtcaacgggccgaac
gaacacccgttatttacctatttgaagactcaattgcccggtctatttggcagcacagcg
atcaaatggaacttcacgaaattcctggttgatcgcaatggcaagccataccgccggtac
gcaccgaccgatctgccatcgcagatcgaagacgacatcgtgttgctcctgcgtcaacag
cccaaatctttgagtgcatag

DBGET integrated database retrieval system