KEGG   Chloroflexus aurantiacus: Caur_3726Help
Entry
Caur_3726         CDS       T00639                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cau  Chloroflexus aurantiacus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_3726
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caur_3726
  Amino acid metabolism
   00310 Lysine degradation
    Caur_3726
Enzymes [BR:cau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caur_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4953859..4955205)
Genome map
AA seq 448 aa AA seqDB search
MAYEIRVPSLGESIVEATVARWLKREGEPVAVGEPVVELETDKVNLEVAADQSGILTSIA
CPEGTTVGIGDLLGTIEAGALPKEAPVAAASTTTVAAPVAEPVAATAVNEVLATPVAQRM
AAEHAIDLRTVPGTGPGGRITKEDVMRLVSGTGPSEATAKADEARVHVSHPTPAVVERPQ
PAQPSPAPAPVAPPPPAPAPRPTPPAAPAVVSTNGDRREERQRLSRRRLTIARRLVEAQH
TAAMLTTFNEVDMSAVMALRARHKDSFKERHGVGLGFMSFFTKAVVGALKAFPMVNAEIQ
GEEVVIKYYYDIGIAVGVDEGLVVPVVRDADRKTFAQIEREIAQLAKKAREGTLSLAELQ
GGTFTITNGGVYGSLMSTPILNAPQVGILGMHKIEERPVVVGGQIVIRPMMYVALSYDHR
LIDGSTAVRFLVKVKELIEDPEALLLEG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaaattcgcgtaccgtcactcggtgagtcgattgttgaggcgacggtagca
cgctggcttaagcgtgaaggtgaaccggttgcggttggtgaaccggtagttgaattggag
accgataaggttaatctcgaagtagccgccgatcagagcgggattctgaccagcatcgca
tgtccagaagggactacggttggtattggcgatctgctgggtacgattgaagccggggca
ttgcctaaagaagcaccggtggcggcagccagtacaacaacggtagcggcccctgtcgct
gaaccggtagctgctactgcggtcaatgaagtgctggcgacaccggttgcccagcgcatg
gctgccgaacacgctatcgatttgcgcacagttcccggcaccggccccggcgggcgcatt
actaaagaagatgttatgcggctggtgtcgggtaccgggccgagtgaagcaaccgctaaa
gcggatgaagcgcgggtccacgtcagccatccgaccccggctgtggtagagcgcccacag
cccgctcagccgtcacctgcgccagctccggttgcgccgccaccaccagcaccggcccca
cggccaacgccacctgcagccccggcagtagtcagtacgaatggtgaccgtcgtgaagaa
cgccagcgcctgagtcggcgccgtttaaccatcgctcgccggctggtggaagcgcagcac
accgcagcgatgcttaccaccttcaacgaagtggatatgagcgcggtgatggcgttgcgc
gcccgtcacaaggactcgttcaaagagcggcatggggttggtttgggctttatgtccttc
ttcaccaaagccgtggtcggagcgctcaaagcttttccgatggtaaatgccgagattcag
ggcgaagaggtcgtcatcaagtactactacgacatcggcatcgccgttggtgttgacgag
gggctggtggtgccggttgtgcgcgatgccgaccgtaagaccttcgcacagatcgagcgc
gaaatcgcccaactggcgaagaaggcacgggaaggaacgttgagtctggccgaacttcag
gggggcacattcacgatcacgaatggcggtgtctacggttcgctcatgagcacgccgatt
ctcaatgccccgcaagtaggcattctgggcatgcacaaaatcgaagagcgtccggtcgtc
gtcggcgggcagatcgtcattcgcccgatgatgtacgttgcgctgagctacgaccatcgc
ttgatcgatggcagcacagcagtgcgcttcctggtgaaagtgaaagagctgattgaagac
ccagaggcgttgctgctggaagggtag

DBGET integrated database retrieval system