KEGG   Chloroflexus aurantiacus: Caur_3726Help
Entry
Caur_3726         CDS       T00639                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00020  Citrate cycle (TCA cycle)
cau00310  Lysine degradation
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01130  Biosynthesis of antibiotics
cau01200  Carbon metabolism
Module
cau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Caur_3726
  Amino acid metabolism
   00310 Lysine degradation
    Caur_3726
Enzymes [BR:cau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Caur_3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 5825534
NCBI-ProteinID: YP_001637293
UniProt: A9WBV2
Position
complement(4953859..4955205)
Genome map
AA seq 448 aa AA seqDB search
MAYEIRVPSLGESIVEATVARWLKREGEPVAVGEPVVELETDKVNLEVAADQSGILTSIA
CPEGTTVGIGDLLGTIEAGALPKEAPVAAASTTTVAAPVAEPVAATAVNEVLATPVAQRM
AAEHAIDLRTVPGTGPGGRITKEDVMRLVSGTGPSEATAKADEARVHVSHPTPAVVERPQ
PAQPSPAPAPVAPPPPAPAPRPTPPAAPAVVSTNGDRREERQRLSRRRLTIARRLVEAQH
TAAMLTTFNEVDMSAVMALRARHKDSFKERHGVGLGFMSFFTKAVVGALKAFPMVNAEIQ
GEEVVIKYYYDIGIAVGVDEGLVVPVVRDADRKTFAQIEREIAQLAKKAREGTLSLAELQ
GGTFTITNGGVYGSLMSTPILNAPQVGILGMHKIEERPVVVGGQIVIRPMMYVALSYDHR
LIDGSTAVRFLVKVKELIEDPEALLLEG
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaaattcgcgtaccgtcactcggtgagtcgattgttgaggcgacggtagca
cgctggcttaagcgtgaaggtgaaccggttgcggttggtgaaccggtagttgaattggag
accgataaggttaatctcgaagtagccgccgatcagagcgggattctgaccagcatcgca
tgtccagaagggactacggttggtattggcgatctgctgggtacgattgaagccggggca
ttgcctaaagaagcaccggtggcggcagccagtacaacaacggtagcggcccctgtcgct
gaaccggtagctgctactgcggtcaatgaagtgctggcgacaccggttgcccagcgcatg
gctgccgaacacgctatcgatttgcgcacagttcccggcaccggccccggcgggcgcatt
actaaagaagatgttatgcggctggtgtcgggtaccgggccgagtgaagcaaccgctaaa
gcggatgaagcgcgggtccacgtcagccatccgaccccggctgtggtagagcgcccacag
cccgctcagccgtcacctgcgccagctccggttgcgccgccaccaccagcaccggcccca
cggccaacgccacctgcagccccggcagtagtcagtacgaatggtgaccgtcgtgaagaa
cgccagcgcctgagtcggcgccgtttaaccatcgctcgccggctggtggaagcgcagcac
accgcagcgatgcttaccaccttcaacgaagtggatatgagcgcggtgatggcgttgcgc
gcccgtcacaaggactcgttcaaagagcggcatggggttggtttgggctttatgtccttc
ttcaccaaagccgtggtcggagcgctcaaagcttttccgatggtaaatgccgagattcag
ggcgaagaggtcgtcatcaagtactactacgacatcggcatcgccgttggtgttgacgag
gggctggtggtgccggttgtgcgcgatgccgaccgtaagaccttcgcacagatcgagcgc
gaaatcgcccaactggcgaagaaggcacgggaaggaacgttgagtctggccgaacttcag
gggggcacattcacgatcacgaatggcggtgtctacggttcgctcatgagcacgccgatt
ctcaatgccccgcaagtaggcattctgggcatgcacaaaatcgaagagcgtccggtcgtc
gtcggcgggcagatcgtcattcgcccgatgatgtacgttgcgctgagctacgaccatcgc
ttgatcgatggcagcacagcagtgcgcttcctggtgaaagtgaaagagctgattgaagac
ccagaggcgttgctgctggaagggtag

DBGET integrated database retrieval system