KEGG   Chloroflexus aurantiacus: Caur_3825Help
Entry
Caur_3825         CDS       T00639                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Caur_3825 (tpiA)
   01230 Biosynthesis of amino acids
    Caur_3825 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Caur_3825 (tpiA)
   00051 Fructose and mannose metabolism
    Caur_3825 (tpiA)
   00562 Inositol phosphate metabolism
    Caur_3825 (tpiA)
Enzymes [BR:cau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Caur_3825 (tpiA)
Exosome [BR:cau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Caur_3825 (tpiA)
  Exosomal proteins of bladder cancer cells
   Caur_3825 (tpiA)
  Exosomal proteins of melanoma cells
   Caur_3825 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5107004..5107756)
Genome map
AA seq 250 aa AA seqDB search
MRIPLIAGNWKMYKTVGEATTLVRDLLAGLGELSDREAIVCPPFTALAAVAALVADSPLG
LGAQNLYPEAQGAFTGEVSPPMLVDIGCRYVIIGHSERRQYFGESDAFVNRKLRAALAHG
LRPIVCVGESKPQRDAGQAEPIVTAQVRAALLEVPPDQMANVVIAYEPIWAIGTGDTATP
ADAQAMHAAIRATLAELYGSEIAATVRIQYGGSVKPDNIDELMAQPDIDGALVGGASLQA
ASFLRIIHYQ
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattccattaatcgccggcaactggaagatgtacaagacggttggcgaagcaacg
acgctggtgcgcgatttgctggccggtctcggtgaattatcggatcgcgaagctatcgtt
tgtccgcccttcaccgcactcgctgccgtggcagcgctggtcgccgatagcccgctgggg
ttgggggcgcagaatctgtaccccgaagcgcagggtgcgtttaccggtgaggtctcgccg
ccaatgctggttgatattggctgtcgttacgtcattattggtcatagcgagcgtcgtcag
tattttggcgagagtgatgcgtttgtgaatcgaaaattgcgtgccgcccttgcccatggt
ctgcgtcccattgtgtgtgttggcgagagtaagccccagcgtgacgccgggcaggccgag
ccgattgtgacggcacaggtgcgtgctgccctgcttgaggtgcctccggatcaaatggca
aacgtggtgattgcttacgagccgatctgggccattggtaccggcgatacggcaactcct
gcggatgcgcaggcgatgcatgcggcaattcgggcaactctggccgaattgtacggttct
gagattgccgcaacggtacgtatccagtacggtggcagtgtgaagccggataatatcgac
gaattgatggctcagcccgatattgatggtgcgttggttggtggtgcttcgttacaggca
gccagttttctgcggatcatccattatcagtag

DBGET integrated database retrieval system