KEGG   Chloroflexus aurantiacus: Caur_3868Help
Entry
Caur_3868         CDS       T00639                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cau  Chloroflexus aurantiacus
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cau00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5165008..5167275
Genome map
AA seq 755 aa AA seqDB search
MPAFTAHHQRFWLDDRPLFIQAGEFHYFRTPATDWEQRLDLLVRAGFNAVACYIPWLWHQ
PQPDQIDLTGTTHPLRNLAGFLDLAAQKGLYVIARPGPYIMAETINEGIPPWVFDHHPEI
ALINQHGTGENVASFMHPSFLSCVAGWYQAVFAILSPRQITRGGPILMVQLDNEMGMLHW
VRNSFDLNPITMQYFANWLQATYGEDMRVDPQVLATRLRHAEGAAGAQLVADYRRFFRSY
LRDYAQWLTAEARRHGLDTPAVFNIHGFANGGKTFPIGLSQLAGVLRLPDVISATDVYPG
QIGEGTFHQLLLVNAMTCAIQNPDQPLFSIEFQAGGNLDFSNMSSSFYDLHTRLCLSNGM
RAINHYLFFDGENDPILSPVKRHDWGHPVRKDGTLRSHYHRYPRLSQTIASYGEALILAR
PEPVTTIGFRLDDFMTEVNLACTQEETAIITHQREVILFDLIARGLALTQRDFQALDLQH
TAPDPHQVPLLWVMLDCNSDPATEQTLIKYLEAGGNVVLIGRLRADGVLAKTLNVQPHTD
PPFTSRRVHIFTTPDIPASFVQTYQGDLETVFATADGAAVGFRKRVGHGELIMLGASFPI
TNLDDLHVFQQLAAWVNCPAPFTLSTWADVRLSRGPDGDFLFVNHYGDDPLETHIHYQGQ
PLCDGHPIRLPARSGAILPLNWQVRPGITVRYTTVEVRSITETADGLTFTFAQPEGYACF
AVRINQGSTEDRSESIQHVHFTNGTASVQWPIRTT
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcattcaccgctcaccatcaacgcttctggctcgatgatcgaccactgttcatt
caggcaggtgaatttcactacttccgcacaccggctaccgattgggagcagcgcctggac
ttgctcgtgcgtgccgggttcaatgccgttgcctgctatattccgtggctctggcatcaa
ccgcaacccgatcagatcgatctgaccggaacgactcatccgttacgcaatctggccggc
tttctcgatctggcagcgcagaagggactctacgtgattgcgcgtcctggcccatacatt
atggccgagaccatcaatgaaggcattccgccgtgggtctttgatcatcatccagagatt
gctctcatcaatcaacacggcaccggcgagaacgtcgccagttttatgcacccgtccttc
ctgagctgcgttgccggctggtatcaggccgtcttcgcaatcctttcaccacgtcagatt
acccgtggtggcccgatcctcatggtccaactcgataacgagatgggaatgctgcattgg
gtgcggaatagcttcgacctcaacccaatcacgatgcaatacttcgccaactggctccag
gcgacgtatggtgaggatatgagggttgatccccaggtcctggctacacgtctgcgccat
gccgaaggggcagcgggtgcacaactggtggccgattatcggcgctttttccgcagttat
ctgcgtgactatgcgcagtggctcactgccgaagcacgccgacacggccttgacacgcct
gctgtgttcaacatccacggtttcgctaacggtggcaagacctttcccatcggtctttca
caacttgccggtgttttacgcttgcctgatgtcatcagtgccaccgatgtctaccccggt
cagattggcgaaggcaccttccaccagctattgctggttaacgcaatgacctgtgccatc
caaaaccctgatcaaccactcttttccattgagtttcaggcgggtggcaatcttgacttc
agcaatatgtcaagttctttctacgacctgcatacccgtttgtgcctttccaacggtatg
cgggccatcaaccattacctcttctttgatggcgagaacgacccgatcctcagtccggtc
aaacggcacgattggggtcatccggttcgtaaagatggcaccctgcgcagccactaccac
cgatatccgcgtttatcccagaccatagccagctacggtgaggcgctcatcctggctcgt
cctgaaccggtaacaaccatcggctttcgccttgatgatttcatgacggaagtgaatctc
gcatgcacgcaagaagagacagcgatcatcacccatcaacgcgaggtcatcctgtttgat
ctgatcgctcgtggtctcgccctgacccaacgtgattttcaggcgctcgatctgcaacat
accgctcccgatccccaccaggtgccgctactgtgggtgatgcttgactgtaatagcgat
cctgccaccgaacagaccctgatcaagtaccttgaggctggcggcaacgtggtcttgatc
gggcgcttacgggccgatggggtattggcaaaaaccctgaacgttcaaccccacaccgat
ccaccattcacatcacgccgggtacacatctttaccacccccgatattccggccagcttt
gtacaaacctatcagggtgatctggaaaccgtctttgccaccgcggacggtgcggcggtc
ggtttccggaaacgagtcgggcacggcgaactgattatgctcggcgcctcattccccatc
accaacctcgatgatctgcacgtgtttcagcaacttgccgcatgggttaactgtccagcc
ccatttaccctttcgacctgggctgatgtacggctgagtcgtggccctgatggcgatttt
ctgttcgtcaaccactacggcgacgatccgctggaaacgcacattcactatcaaggtcag
ccactttgtgatggtcatcccattcgcctgccggcccgtagtggtgccattcttccgctc
aactggcaggtacgcccagggatcaccgtgcgctatacgacggtggaagttcgctcgatc
acagaaactgccgatggcctgaccttcaccttcgcccaacccgaaggctatgcctgcttt
gctgtacgtatcaatcagggaagtacagaagataggagtgagtcgatacaacacgttcac
tttaccaatggcaccgcatctgtgcaatggcccatcagaacgacataa

DBGET integrated database retrieval system