KEGG   Chloroflexus aurantiacus: Caur_3875Help
Entry
Caur_3875         CDS       T00639                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cau  Chloroflexus aurantiacus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cau00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5177928..5179481
Genome map
AA seq 517 aa AA seqDB search
MTTTNGSPVQVRGFGLQRASGILLHPSSLPGPWGIGDLGPMAYRFVDFLVAAGQSLWQVL
PLGPTGYGDSPYQCFSAFAGNPLLISLDDIIEQGLLTIEEARATLSRLPADRVDYGALIP
AKQSLLRRSFERFQSGHGAHLRPDYQRFCEANAEWLTDYAQFMAIKESQGGVSWHDWRPD
LRDRKPAALGQARHELATTIAYHQYLQFLFFRQWQSLKAYANQQGVLIIGDAPIFVADDS
ADVWANRDLFFVDEHGRPTVVAGVPPDYFSATGQRWGNPLYRWERMAATGYRWWVARMRQ
AFTLYDILRLDHFRGFEAYWEVPASAPTAVDGRWVAGPGADLFNVLQAELGTLPIIAEDL
GLITPEVEALRQAFELPGMKVLQFAFGYDPANPYLPHNYTPNYVVYTGTHDNDTTIGWFA
TLDPATRAAVLTYLGRTEETIDIAWDLMRLGMMSVANYAITPLQDVLRLGSEARMNTPGR
LGGNWAWRFSAEALSAELADRLRQLTFIYRRLQPANT
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaactaacggctctccagttcaggtgcgaggatttggactgcaacgggcaagc
ggcattctccttcatccctcatccctacccggcccatggggaatcggtgatcttggcccg
atggcgtatcgattcgtcgattttttggttgcggcggggcaatcactctggcaggtgctc
ccgcttggccctaccggctacggtgactcgccctaccagtgcttttcggcctttgccggc
aatccattgttgatcagtctggatgacatcatcgaacagggattgctcacgattgaggaa
gcacgggccacactgtccagattacccgccgaccgggttgattacggggcactcattcca
gccaaacaatccctgctgcgtcgtagcttcgagcgattccagagcggtcacggtgcgcac
ttgcgcccagactatcagcggttctgcgaagccaacgcggagtggctaaccgattatgct
caatttatggccatcaaggaatcgcaagggggcgtaagctggcacgactggcgtcccgat
ttgcgtgatcgtaaaccggccgcccttgggcaagccaggcatgaactggcgacgacgatt
gcctaccatcaatatctgcaatttctcttcttccgccagtggcaatcgctcaaagcctat
gccaatcagcagggtgtgctgatcatcggcgatgctcccatttttgttgccgacgacagt
gccgatgtgtgggccaatcgtgatctcttttttgtggatgaacatggtcgaccgaccgtg
gttgccggtgtaccaccagactacttcagcgccaccggtcagcgctggggcaatcctttg
tatcgctgggaacgcatggccgccaccggttaccgctggtgggtcgcccgcatgcgccag
gccttcacgctctacgacatcttgcgcctcgaccattttcgcggttttgaagcctattgg
gaagtaccggcgagtgcaccgactgcggtagatgggcgctgggtagcagggccgggggcc
gacctcttcaacgtcttgcaggccgagctgggaacacttcccatcatcgccgaagacctt
ggtttgattacccctgaagttgaagccctccgccaggcatttgaactacccggcatgaag
gtgctccagttcgccttcgggtatgatccggccaatccttacctaccccacaactacacc
ccgaattatgtcgtctataccggcacgcacgacaatgatacgacgattggctggtttgcc
accctcgatccggctacccgtgcggcagtgttgacctaccttggccgtactgaagagacg
attgatattgcctgggatttgatgcgcctgggcatgatgtctgttgctaactatgcaatt
acgccattgcaagacgttttgcgtctgggatcagaggcgcgcatgaacacccccggtcga
ttgggtggtaactgggcatggcgcttttcggctgaagcgctcagcgcagaactggccgac
agattgcgtcaacttacatttatctaccgccgacttcagccggcaaacacctga

DBGET integrated database retrieval system