KEGG   Chloroflexus aurantiacus: Caur_3889Help
Entry
Caur_3889         CDS       T00639                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
cau  Chloroflexus aurantiacus
Pathway
cau00630  Glyoxylate and dicarboxylate metabolism
cau01100  Metabolic pathways
cau01110  Biosynthesis of secondary metabolites
cau01120  Microbial metabolism in diverse environments
cau01200  Carbon metabolism
Module
cau_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cau00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Caur_3889
Enzymes [BR:cau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Caur_3889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 5825699
NCBI-ProteinID: YP_001637455
UniProt: A9WDE7
Position
complement(5201664..5202938)
Genome map
AA seq 424 aa AA seqDB search
MDRAAQIKQIADSWNTPRFAGIVRPYTPEDVYRLRGSVQIEYTLARMGAERLWNLLHTEP
YINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPANSGPQLVRNI
NNALRRADQIYHSEGRNDIYWFAPIVADAEAGFGGPLNVFEIMKAYIEAGAAGVHFEDQL
ASEKKCGHMGGKVLIPTQAAIRNLVAARLAADVMGVPTIIVARTDANAATLLTSDIDERD
RPFCTGERTSEGFYRVRAGLDQAIARGLAYAPYADMIWCETSEPNLEEARRFAEAIHAQF
PGKLLAYNCSPSFNWKKKLDDATIAAFQRELGAMGYKFQFVTLAGFHALNYSMFELARNY
RDRGMAAYSELQQAEFAAEAYGYTATRHQREVGTGYFDEVAQVIAGGEISTTALTGSTEE
EQFH
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtgccgcacagatcaagcagattgccgacagttggaacacgccgcgttttgcc
ggcattgtgcgcccctacacgccggaggatgtgtatcgtctgcggggttcggtgcagatt
gagtacaccctggcgcggatgggtgccgagcgcttgtggaacctcttgcacaccgagccg
tacatcaatgccctgggtgccctaacgggtaatcaggcaatgcagcaggtgaaagccggt
ctgaaagccatctacctgagtggctggcaggtagccgccgatgccaatctggcggggcag
atgtatcccgatcagagcctctatccggcaaattcaggcccccaactggtgcgcaacatc
aacaatgccctccgccgtgccgaccagatttatcacagcgaagggcgaaatgacatttac
tggtttgccccgattgtggccgatgccgaagccggctttggtggcccactcaatgtcttc
gagattatgaaggcgtatatcgaagccggtgcggcaggtgtacacttcgaggatcagctt
gcctccgaaaagaagtgtggtcatatgggcgggaaggtgttgatccccacccaggctgcg
attcgtaatctggtggcggctcgtctggcagccgatgtgatgggggtgccgacgatcatt
gtggcgcgcaccgacgcaaatgcggctacgttgctcaccagtgatattgatgagcgggat
cggcccttctgcaccggcgagcgcaccagcgagggcttctaccgggtgcgggcgggcctt
gatcaggcgattgcccgtggtctggcctatgccccctacgccgatatgatctggtgtgaa
acgagcgagccaaatctcgaagaggcacgccgctttgccgaggctattcacgcccaattc
cctggcaagttgctggcctacaactgttcgccatcgttcaactggaagaagaagctggac
gatgcgacgattgcggccttccagcgcgaattgggtgccatgggctacaagttccaattc
gtgaccctggccggcttccacgcgctgaactacagcatgtttgaactggcgcgcaactat
cgtgatcgggggatggctgcctacagcgaattgcaacaggcggaatttgccgcagaagcc
tacggttacacggcgacccgtcaccagcgtgaagttgggaccggttatttcgatgaggtg
gcgcaggtgattgccggtggcgagatcagcacaacggcattgaccggcagtactgaggaa
gagcagttccactag

DBGET integrated database retrieval system