KEGG   Candida auris: QG37_03818Help
Entry
QG37_03818        CDS       T04850                                 

Definition
(RefSeq) inulinase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
caur  Candida auris
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caur00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    QG37_03818
   00500 Starch and sucrose metabolism
    QG37_03818
Enzymes [BR:caur01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     QG37_03818
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 521 aa AA seqDB search
MLGLLFCLVSLISFAMALTEDPRPLIHFTPQNGWMNDPNGPWFDEKEQLWHLYFQYTPND
TTGLLDLHWGHATSTDLSTWVDHGVAIAPEEKGQGIFSGSVVVDHNNTSGFFDDDIDPRQ
RVVALYTLNSKDAQTQEVAYSIDGGYSFTKYEANPVLDVNSKQFRDPKVFWHEPSNHWVM
VLAKSQEYKIQIFGSTDLKNWVLHLNFSAGLYGFQYECPGLFELPIEGEDKKKWVMLLAI
NPGMPLGGSANQYFIGDFDGYRFIPDDSQTRIHDHGKDFYAFQSFSDAPLEDGVLGVAWA
SNWQYAKHVPTKEWRGSTGIVRNHTLARMPANPESDLLTLVQKPVIGSSVKAERLVEEKN
LTLSLSDPISAKANKTGVFDIELTFTVSAEKKVSKVINISILSNSHNGTKEEITLGYDAN
VEAFYVDRGIDNKFNKNPFFTDKISAFVEPLKTDKDSNKTFNLRAIVDKNLLEVFLNDGS
STITNTFFMSEGSLPESVVLSASTDDTYVVDFAVDELSLRH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcttggtctgttattttgtttggtctctctcatctcctttgcaatggccttgacggaa
gacccccggccgctcattcattttaccccacaaaatggctggatgaacgatccaaacgga
ccttggttcgacgaaaaagaacagttgtggcatctatacttccagtacacccctaacgat
actacaggtctgctggacctccattggggtcatgctacgtccacggacttgagtacttgg
gtggatcatggggtagctattgcgcctgaagaaaaaggacagggaatcttctctggttct
gttgtggtggaccacaacaatacttcaggattctttgatgatgacattgatcctcgtcag
agggtggttgccttgtacacattgaactccaaggacgctcagacacaggaagtagcctat
tctattgatggtggctacagcttcaccaagtacgaggccaaccccgttcttgatgtcaat
tctaagcaatttcgtgatcctaaggtcttttggcatgaaccctcaaatcattgggtcatg
gtgttggctaaatctcaggagtataaaatccagatttttgggtccacagacttgaagaac
tgggtgttacacctgaacttttctgctggtctttatggttttcagtacgagtgtccaggg
ctttttgaactcccaattgagggggaggacaagaagaagtgggtgatgcttttggcaata
aacccaggcatgcctctaggtggctctgcgaatcaatactttattggcgattttgacggc
tacagatttattcctgatgacagtcagacccgtattcatgatcatgggaaggatttttat
gctttccagagcttcagcgatgcacctttggaagatggtgttttgggggttgcttgggct
tctaactggcaatatgcgaagcacgttcccacgaaagagtggagggggtccacgggaatt
gtgagaaaccatacattagcacgaatgccagccaatccggaaagcgacttgttgactttg
gtccaaaaacctgtgataggtagctcagtcaaggcagagcgattagttgaagaaaagaac
ctaaccttgagtctgtctgaccccatctcagctaaagctaacaaaacaggcgtttttgac
atagaattgactttcactgtgtcggctgagaagaaagtcagcaaggtgattaacatcagt
atcttatcaaacagtcataatggtaccaaagaagagatcacactaggctacgatgccaat
gtggaggcattttatgtcgatcgaggcattgacaacaaattcaacaaaaatccgttcttt
acagataaaatttcggctttcgtggaacccctcaaaacagacaaggactcaaacaagacg
ttcaatttgagggcaattgtggacaaaaatcttttggaggtctttttaaatgatggctca
agcacgataacgaacacattttttatgagtgaaggctcgttaccagaatcagtagtgctt
agtgcatccacggatgatacatacgtggttgatttcgctgtggatgaactttccttgaga
cactaa

DBGET integrated database retrieval system