KEGG   Carnobacterium sp. WN1359: Q783_00090Help
Entry
Q783_00090        CDS       T02884                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
caw  Carnobacterium sp. WN1359
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:caw00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17900..19360
Genome map
AA seq 486 aa AA seqDB search
MLKNGLMMQYFEWYIEDDGNHWKRLKEDAKHLSEIGITSVWIPPCFKGTGTQDNGYGIYD
LYDLGEFDQKGTIRTKYGTKEELIAAIDELHKYEIQVYADVVLNHKAGADGVERFKAIEV
DPDDRNQTISEPYEIEGWTEFTFPGRKGKYSDFQWHWYHFSGTDYNQENEKKAIYRIEGQ
NKGWADDETVDNEYGNYDYLMYADIDYSHPEVVEETKKWANWFIAETGVDGFRLDAVKHI
NENFIYELRESIESNFGKQFFIVGEYWDQNYSSLKNYLESQGYKMDLFDVGLHHQLEQAS
KMGNEFDLTQLFDQTLIQNNPMQAVTFVDNHDSQPNQSLESFIEPWFKPAAYGVILLRQE
GYPVLFYGDYYGIKGDDPIEPQREVIDKLLYLKKNYAYGNQTDYFDHRNCIGWTRSGNEE
YPKGCAVVISNSEAGFKDMFVGEDKSGCVYEDYLGNCTNKITIDEEGNGHFLVEAGSVSV
WVNKEE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaatggactaatgatgcaatattttgagtggtatatagaagatgatggtaac
cattggaaacgtttaaaggaagatgcaaaacatttaagtgaaattggaataaccagtgta
tggattccaccatgttttaaaggtacaggaacacaagacaatggatacggaatatatgat
ttatacgatttaggtgagtttgatcaaaaaggtactatccgcacaaagtatggtacaaaa
gaagaattaatagcagcaattgatgagctgcataaatacgaaatccaagtttatgcagat
gttgttttaaatcataaagcaggcgcagatggagttgaacgatttaaagcgattgaagtg
gatcctgatgatcgcaatcaaacaatcagtgaaccctatgaaattgaaggatggacagag
tttacttttccaggtagaaaagggaaatactctgatttccaatggcattggtaccatttt
tcaggaacggattacaatcaagaaaacgagaaaaaagctatttatcgtattgaaggtcaa
aataaaggctgggccgatgacgaaacagtagataacgagtatggcaattacgattacctc
atgtatgctgatattgattatagtcatccagaagttgttgaagaaacaaaaaaatgggct
aattggtttattgcagaaactggagtagatggttttaggttagatgctgtcaaacatatt
aacgaaaattttatttatgaattacgcgaaagtattgaatctaattttggcaaacaattt
tttattgtgggagagtattgggaccaaaattactctagtttaaagaattatttagagagc
caaggctataaaatggatctatttgacgtaggattgcatcaccaattagaacaagcttca
aaaatgggtaacgaatttgatttgacacaattatttgatcaaacgttaatccaaaataat
cccatgcaagctgtaacttttgtagataatcatgattctcaaccaaatcaatcgctggaa
tcctttattgagccatggtttaagcctgcagcttatggagttatcttactaagacaagaa
ggctatccagtgctcttttacggtgattattacggtatcaaaggggatgatccgattgaa
cctcaacgtgaagtaatcgataaattattgtaccttaaaaagaattatgcttatggaaat
caaacagattattttgatcacagaaattgtattggttggactcgatcaggaaatgaagag
tatccaaaagggtgtgctgtagtcatctcaaatagtgaagctggctttaaggatatgttt
gtaggagaagacaaaagcggatgcgtttatgaagattatctaggtaattgtacaaataaa
ataacgattgatgaagaaggtaatggtcattttcttgtagaagctggttctgtatctgtg
tgggtgaataaagaagaataa

DBGET integrated database retrieval system