KEGG   Carnobacterium sp. WN1359: Q783_00090Help
Entry
Q783_00090        CDS       T02884                                 

Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
caw  Carnobacterium sp. WN1359
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:caw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q783_00090
Enzymes [BR:caw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Q783_00090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
17900..19360
Genome map
AA seq 486 aa AA seqDB search
MLKNGLMMQYFEWYIEDDGNHWKRLKEDAKHLSEIGITSVWIPPCFKGTGTQDNGYGIYD
LYDLGEFDQKGTIRTKYGTKEELIAAIDELHKYEIQVYADVVLNHKAGADGVERFKAIEV
DPDDRNQTISEPYEIEGWTEFTFPGRKGKYSDFQWHWYHFSGTDYNQENEKKAIYRIEGQ
NKGWADDETVDNEYGNYDYLMYADIDYSHPEVVEETKKWANWFIAETGVDGFRLDAVKHI
NENFIYELRESIESNFGKQFFIVGEYWDQNYSSLKNYLESQGYKMDLFDVGLHHQLEQAS
KMGNEFDLTQLFDQTLIQNNPMQAVTFVDNHDSQPNQSLESFIEPWFKPAAYGVILLRQE
GYPVLFYGDYYGIKGDDPIEPQREVIDKLLYLKKNYAYGNQTDYFDHRNCIGWTRSGNEE
YPKGCAVVISNSEAGFKDMFVGEDKSGCVYEDYLGNCTNKITIDEEGNGHFLVEAGSVSV
WVNKEE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaaatggactaatgatgcaatattttgagtggtatatagaagatgatggtaac
cattggaaacgtttaaaggaagatgcaaaacatttaagtgaaattggaataaccagtgta
tggattccaccatgttttaaaggtacaggaacacaagacaatggatacggaatatatgat
ttatacgatttaggtgagtttgatcaaaaaggtactatccgcacaaagtatggtacaaaa
gaagaattaatagcagcaattgatgagctgcataaatacgaaatccaagtttatgcagat
gttgttttaaatcataaagcaggcgcagatggagttgaacgatttaaagcgattgaagtg
gatcctgatgatcgcaatcaaacaatcagtgaaccctatgaaattgaaggatggacagag
tttacttttccaggtagaaaagggaaatactctgatttccaatggcattggtaccatttt
tcaggaacggattacaatcaagaaaacgagaaaaaagctatttatcgtattgaaggtcaa
aataaaggctgggccgatgacgaaacagtagataacgagtatggcaattacgattacctc
atgtatgctgatattgattatagtcatccagaagttgttgaagaaacaaaaaaatgggct
aattggtttattgcagaaactggagtagatggttttaggttagatgctgtcaaacatatt
aacgaaaattttatttatgaattacgcgaaagtattgaatctaattttggcaaacaattt
tttattgtgggagagtattgggaccaaaattactctagtttaaagaattatttagagagc
caaggctataaaatggatctatttgacgtaggattgcatcaccaattagaacaagcttca
aaaatgggtaacgaatttgatttgacacaattatttgatcaaacgttaatccaaaataat
cccatgcaagctgtaacttttgtagataatcatgattctcaaccaaatcaatcgctggaa
tcctttattgagccatggtttaagcctgcagcttatggagttatcttactaagacaagaa
ggctatccagtgctcttttacggtgattattacggtatcaaaggggatgatccgattgaa
cctcaacgtgaagtaatcgataaattattgtaccttaaaaagaattatgcttatggaaat
caaacagattattttgatcacagaaattgtattggttggactcgatcaggaaatgaagag
tatccaaaagggtgtgctgtagtcatctcaaatagtgaagctggctttaaggatatgttt
gtaggagaagacaaaagcggatgcgtttatgaagattatctaggtaattgtacaaataaa
ataacgattgatgaagaaggtaatggtcattttcttgtagaagctggttctgtatctgtg
tgggtgaataaagaagaataa

DBGET integrated database retrieval system