KEGG   Carnobacterium sp. WN1359: Q783_01590Help
Entry
Q783_01590        CDS       T02884                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
caw  Carnobacterium sp. WN1359
Brite
Enzymes [BR:caw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Q783_01590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330010..330762
Genome map
AA seq 250 aa AA seqDB search
MAIHSFFFEKGPQAVILMHAYSSTPNDVRMLARALEKENYTVYAPLFKGHGTDDPEDILA
ASPKDWVRDAKEAIHFLKEKGYQEIAVFGLSLGGIIATKMLVDSEPIVAGGTFCSPVVNF
HSENNVKEAFLTLVRIMKKKAGYSELEINDRMPEVERKLTNQLTELNELTKSMGNQYSEI
KKPVFIAQAGQDEMINPELSIAFKESLKQAPVVDFHWYEDSKHAVTVGVDRKALQTDVSS
FLKQLDWNGG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcaatacactcatttttttttgaaaagggtcctcaagcagtaatcttgatgcatgcg
tattccagcacacccaatgatgtacgaatgttggcaagagccttagagaaggaaaattat
acggtctatgcgcctttatttaaagggcacggaacagatgatcccgaagatattttagca
gcatctccaaaagattgggtaagagatgcaaaagaagctatccacttcctaaaagaaaaa
gggtatcaagaaatagccgtttttgggttatctttaggcggcataatcgcaacaaaaatg
ctggttgatagtgaaccgatagtggcaggtggaacattttgttcaccagttgtaaacttt
cacagtgaaaataatgttaaagaagcatttttaacattagtacgaataatgaaaaagaaa
gcaggttattcggaactagagataaatgaccgaatgccagaagtagaacgtaaattaaca
aatcaattaactgaattaaacgaattaaccaaatcaatgggaaatcagtacagtgagata
aagaaaccagtttttatcgcgcaagctggtcaagacgaaatgatcaacccggagctttct
atagcttttaaagagtcattgaaacaagctcctgtggtagattttcattggtatgaagac
agtaaacatgctgtaaccgtgggtgtagatcgtaaagcgttgcaaacagatgtcagcagc
tttttaaaacagttagattggaatggaggataa

DBGET integrated database retrieval system