KEGG   Carnobacterium sp. WN1359: Q783_03135Help
Entry
Q783_03135        CDS       T02884                                 

Definition
penicillin-binding protein 1A
Orthology
K12555  
penicillin-binding protein 2A [EC:2.4.1.129 2.3.2.-]
Organism
caw  Carnobacterium sp. WN1359
Pathway
beta-Lactam resistance
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:caw00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Q783_03135
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Q783_03135
Enzymes [BR:caw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     Q783_03135
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Q783_03135
Glycosyltransferases [BR:caw01003]
 Polysaccharide
  Bacterial polysaccharide
   Q783_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
644858..646990
Genome map
AA seq 710 aa AA seqDB search
MNESPFFDKVKKALLIFWEWIKPYLIKFHKKRQRVWKRYQINKIILLTVLTIALAASVYL
LYLAKTANVSTLKAGLEQTTTIYDVNNEEAGTLYSQKGTFVSIDEVSDSIEQAVISTEDK
RFYKHSGFDPIGIARAAVGYILNGGNIVGGGSTITQQLAKNAYLTLDQTVIRKLKELFLA
IEIEKVYTKDEIIEMYLNNSYFGNGVWGVEDASQKYFGKSAADVTLSEAATIAGMLKAPS
NYNPIDNYDNAISRRNVVLDLMATNELVTQEEVDELKAQELTLVDAYSEKEGYQYPSYFD
AVINEAMYTYDLSEEAVLNKGYKIYTSLNQDYQRAMDVTYENDYLFQNAADGTLLESGSV
ALDPETGGVFAIYGGRKEHTFRGFNYATQMVRQPGSIIKPLAVYTAALEQGYSIDSMLVD
EPLPYGKDKYTPENVDDQYEGEVPMYQALAESKNAPAVWLLNEIGLNKGFKKVEEFGIPL
VEGTEGDEYLGLALGGLSKGVSPLQMASAYTTFANEGVMSEGHFITKIVDATGAVIVDNT
NSKKTKITTPEVADQMTSMLMGVFTNGTAQNNNPSGYTIAGKTGSTEVTFNDSGGTTDQW
TVGYTPDIVIATWMGFDPTDENHYMTTGSSTGVGPLFKQQMENILPYTELTAFNTQSAEK
IVAEEAENEDGSNDWKQDVKDTIDSIGGKVKEGSDILKDKFGNLLDKFTN
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatctcctttttttgataaggtaaaaaaagctctgcttattttttgggagtgg
ataaaaccctatttgataaagtttcataaaaaaagacaacgagtttggaaaagataccag
ataaataaaattattcttttgactgttttaaccattgctttagcagcaagtgtttattta
ttgtatttagcaaaaacagcaaatgtctctaccttgaaagcaggtttagaacaaacaaca
acgatatatgatgtcaacaatgaagaagcaggaacattgtattctcaaaaaggaacattt
gtctcaatcgatgaagtatcagattctatagaacaagctgttatttcaactgaagataaa
cgtttttataaacactcaggatttgatcctattggaattgcaagagctgctgtaggatat
atccttaatggagggaatattgttggaggtgggagcaccattactcaacagttagccaaa
aatgcctatctaacgcttgatcaaactgtaattcgaaaactaaaagaactgtttttagct
attgagattgaaaaagtgtatacaaaagatgagattatcgagatgtatcttaataattct
tattttggaaatggtgtatggggagtagaggatgcgtctcaaaaatattttgggaaatct
gcagcagatgttactttatcagaggcagctacaatagcaggtatgctaaaagctccaagt
aattacaatccgattgataattacgataatgctatctctcgaagaaatgtagtattagat
ctaatggcaacaaatgaactagttactcaagaagaagtggatgaactaaaggctcaagaa
ttaacattagtagatgcttattcagaaaaagagggctatcaatacccatcatattttgat
gctgtaataaatgaagccatgtatacctatgatttaagtgaagaagctgttttaaataaa
ggctataaaatttatacttctttgaatcaagactatcaacgtgccatggatgtgacttac
gaaaatgattatttgttccaaaatgcagcagatggaactcttttggaaagtggatcggta
gctttagatccagagaccggtggcgtatttgctatttatggtggtcgaaaagaacataca
tttagaggatttaattatgcgacgcaaatggttagacaaccaggttctattataaaaccc
ctagctgtctacacagcagctcttgaacaaggttactctattgattccatgctcgttgat
gaacccttgccatatggtaaagataaatacacacctgaaaatgttgacgaccaatatgaa
ggtgaagttcctatgtaccaagcattagcagaaagtaaaaatgctcctgcagtatggttg
ttaaacgaaattggcttaaataaaggatttaaaaaagttgaagaatttggtattccgtta
gtggagggtactgaaggagacgaatatctaggactggcattaggaggcttaagtaaaggc
gtttctcctctccaaatggcaagtgcttatacaacttttgcgaatgaaggagtcatgagt
gaaggacactttattactaaaatcgttgatgctacaggtgcggttattgttgacaatact
aattctaaaaaaactaaaattacaactccagaagtagcggaccagatgaccagtatgctg
atgggagtatttactaatggaacagcacagaataataatccatcagggtatacaatagct
ggtaagacagggagtactgaagtaacgtttaatgattcgggcggtactacagaccaatgg
acagtcggatacacgccggatattgttattgcaacttggatgggatttgaccctactgat
gaaaatcactatatgacgacgggaagttctactggtgtcggaccattatttaaacaacaa
atggaaaatattttaccttatactgaacttacagcttttaatacacaaagtgctgaaaaa
atcgtagctgaagaagcagaaaacgaagatggatcgaatgactggaagcaagatgtcaag
gatacaattgattcgataggtggaaaagtaaaagaaggatcagatattttgaaagataaa
tttggaaatctccttgataaatttaccaattga

DBGET integrated database retrieval system