KEGG   Carnobacterium sp. WN1359: Q783_03240Help
Entry
Q783_03240        CDS       T02884                                 

Definition
5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
caw  Carnobacterium sp. WN1359
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:caw03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
671162..672001
Genome map
AA seq 279 aa AA seqDB search
MPELPEVETVRKGLEQLVLGATIQSVDVYWDRIVAGSIDSEEFKQLLVGETIIEFDRRGK
YIIFRFEHWALVSHLRMEGKYEVENSTAPLKKHTHIVFHLTDGRDLRYLDVRKFGRMTLV
PLGKEFSTTGIRLLGPEPTKEAFDGKTFYTTLQTKKRSIKPLLLDQTIVAGLGNIYVDEA
LFVAKIHPMRAANSLSKNEVSRLHESIIKVLGDAVKAGGTTIRTYKNALGDAGTFQVKLA
VYGKKGSPCIRCGTPIEKIKVAQRGTHFCPNCQQLDSDY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgcctgaattaccagaagttgaaacggttagaaaaggtttagaacaacttgtattaggc
gcaacgattcaatcagtagatgtttattgggaccgtatcgttgctggatctatcgatagc
gaagaatttaaacagcttttagttggagaaacgatcatagagtttgatagacgaggaaaa
tacattattttccgttttgaacattgggctttggtttctcatttgcgtatggaaggtaag
tatgaggtagaaaattcaacagcacctttaaaaaaacatacacatatcgtttttcattta
acagacggaagagatttacgttatctggatgtacggaaatttggtcggatgacacttgtt
cctttaggaaaagagtttagtacgacaggtataaggctacttggtcctgaaccgactaaa
gaagcttttgatggaaagacattttatactacactacaaactaaaaaacggtctattaag
cctctgttattggatcaaacaattgtagctggattaggaaatatttatgtagatgaagct
ttatttgtagctaagatccatccgatgagagctgcaaatagcttaagtaaaaatgaagtt
tcaaggttgcatgaatccattatcaaagtcttaggggatgctgtaaaagctggtggaacg
acgattcgcacttataaaaatgcacttggagatgctgggacatttcaagtgaaattagcg
gtttatggtaaaaaaggaagtccgtgtattcgatgtggaacgcctatagaaaaaataaaa
gtagctcaacgaggaactcatttttgtcctaattgccagcaattagacagtgattactaa

DBGET integrated database retrieval system