KEGG   Carnobacterium sp. WN1359: Q783_03300Help
Entry
Q783_03300        CDS       T02884                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
caw  Carnobacterium sp. WN1359
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caw00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Q783_03300
Enzymes [BR:caw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Q783_03300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
684686..686089
Genome map
AA seq 467 aa AA seqDB search
MKRAKKRIAVIGGGITGLVTAYRIKQQIIKENLPFELIVLESSLKVGGKIQTIKVGENYF
DLGAESIDIRYPEAMELINELGLSDQLVYSKGNKPDIFFYNKLHSLNYPTYKGIPVRKMD
IWKNDLLTFHGKMASFKDNIFPLKPLDKDIEMSTYLKNRFGEELTEHIVEPFFSKIYASD
LDEMGIKSSKEVIYSLEQKYGSLSKGIKHHPELLDGSGNYVTFKKGLSVLTDKLIEILEP
HIQTSKKVFEIKENLEGTYIIDINRKEQMRVGAVCIATPVTEYSKLLNNETFGQVFDQVE
TASIGYILFKFKKDAIKNEPEGFGVVTPRRSDSFVTSIVILNKKWDFLKDEESVFVGVSF
GRKGEDLLVSLSNNEIEDSILKDLEMILGITEKPIDQIVKRWPDAIPQYTVSQEGKIKEI
IELLSLNYPGIYISGIGLEGFGINQCIGQANKISKKIVAHIKKQNCI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagagccaaaaaaagaattgcagtaattggtggaggtataactggattagttact
gcatatcgaatcaaacagcaaatcataaaagaaaacctaccttttgaacttattgtatta
gagtcttctttaaaagtaggaggtaaaattcaaaccataaaagtaggcgaaaattatttt
gatttaggagctgaatcaattgatattcgatatcccgaagcaatggaactaatcaatgaa
ttaggtctaagtgatcagttagtttacagcaaaggaaataaaccggatatctttttttat
aataagttacatagtcttaactatccaacttataaaggtattccagtaaggaaaatggat
atttggaaaaatgatttgctaactttccatgggaaaatggctagtttcaaagataatata
tttcccttaaaacccttagataaagatattgaaatgagtacgtacttgaaaaataggttt
ggagaagaattaacggaacacattgtagaaccttttttctcaaaaatctatgctagcgat
ttagatgaaatgggcatcaaatcttccaaagaagttatttattcactagaacaaaaatat
ggaagtctttcaaaagggattaaacatcatccagaattactagatggatctggtaattat
gttacctttaaaaaaggattatctgttttaacagataaactaattgaaattttggaacca
catattcagacaagcaagaaagtttttgaaattaaagaaaatctcgaaggaacctacatt
atagatattaatcgaaaagaacaaatgcgtgttggtgctgtgtgtattgccactccagta
accgagtattccaaattactaaataacgagaccttcggacaagtttttgatcaagttgaa
acagcatcaattgggtatatcttatttaaatttaaaaaagatgctataaaaaatgagcct
gaaggttttggcgtagtcactcctagaagaagtgattcttttgtaacttccattgttatt
ttaaataaaaagtgggattttcttaaagatgaagaatctgtttttgttggtgtaagtttt
ggtcgaaaaggagaggatctactcgtctctttaagtaacaacgaaatagaagactctata
ttaaaagatttagaaatgatacttggaattactgaaaaaccaatagatcaaatagtaaaa
cgatggcctgatgctatacctcaatacactgtgtctcaagaaggaaaaatcaaagaaatt
attgaattattatctcttaattatcctggaatttatatttctggaataggattagaaggt
tttggtatcaaccaatgtattggtcaagcaaataaaataagtaagaaaatagttgcacac
attaaaaaacagaattgtatttaa

DBGET integrated database retrieval system