KEGG   Carnobacterium sp. WN1359: Q783_06755Help
Entry
Q783_06755        CDS       T02884                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
caw  Carnobacterium sp. WN1359
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:caw00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Q783_06755
Enzymes [BR:caw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Q783_06755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1377705..1378610)
Genome map
AA seq 301 aa AA seqDB search
MSKITVIGSISTDFVVTADKRPEVGETITGKEFNTTFGGKGANQAVASARLGGDVYMAGT
VGTDIFATELLANLSTNNIHVDYVEPVTHVPSGSAHITIVDGDNSIVYIPGANNAIGTKR
IEGLSELIKTSTIVVVQNELPQEVVDQIIEMCYEFSVKVIYNPAPARKVNQSVLEKATYL
TPNESEFKLLFPELTISEGLAKYPNQLIITMGSKGVYYHDGTSEKQISSYTVTPVDTTGA
GDTFNGAFAVALTAGLDLESSIRFGNLAASLSIKKFGAQGGMPSLIEMKESEHYEKTWHI
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaattaccgtaatcggaagcatctctacagattttgtagtgacagctgataaa
agaccagaagttggggaaaccatcaccggaaaggaatttaatacgacctttggcggtaaa
ggagctaaccaagcagttgcaagtgctcgtttaggcggagacgtttatatggcgggaacc
gttggaacagatatttttgcaaccgaactattggcaaatctttcaacaaataatattcat
gtagactatgtggaacccgttacacatgttccatctggatcagctcatatcacgatcgtt
gatggagataacagcatcgtgtacattcctggagcgaataatgccatcggtaccaaaaga
attgaagggttaagcgaactgattaaaacaagcacgatcgttgtcgttcaaaatgaattg
ccgcaagaagtggtagaccaaattattgaaatgtgctacgaatttagcgtaaaggtaatc
tataatccagctcctgctagaaaagttaaccaaagtgtattagaaaaagcaacgtatcta
acacctaatgaaagtgaatttaaattgcttttcccagaactaacgatttctgaaggacta
gcaaaatatccgaatcagttgatcataacgatgggatctaagggtgtctattatcatgat
ggtacgagtgaaaaacagatttcttcttataccgttacaccagtcgacacaacaggtgcc
ggagatacatttaacggcgcatttgcagtggcgcttacagcagggttggatttggaatcc
agtattcgattcggaaatttagctgcatcattatccatcaaaaaatttggtgctcaaggt
ggaatgccttcattaatagaaatgaaagagagtgaacattatgaaaaaacatggcatatt
gaatag

DBGET integrated database retrieval system