KEGG   Carnobacterium sp. WN1359: Q783_08020Help
Entry
Q783_08020        CDS       T02884                                 

Definition
glycogen-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
caw  Carnobacterium sp. WN1359
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:caw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Q783_08020
Enzymes [BR:caw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Q783_08020
Exosome [BR:caw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Q783_08020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1647539..1649464)
Genome map
AA seq 641 aa AA seqDB search
MTHLSMSEEVKKKLEEELFLFNTGEYFDSYLTLGCNRDTYEGNSGFRFTVWAPNAISMAV
VGDFSDWDLGIEMEKIGKTGCWTAFSDKAIEGQCYKYRIEQPDGTVKLKIDPYAFEFEVR
PKDASIVKGLPEKKWKDGLWSANKKRFSIYERPLNIYEVHLSSWKHHDDGSWYTIPELKN
ELIPYVKKMGYTHIEFMPLMEHPLDASWGYQLTGYYALSSKFGTMEEFQDLVEAAHLANI
GVIMDWVPGHFNRNDYGMVHFDGTPQFEYTDKNKAQNNRWGTMNFDLGKAQVQSFLTSNA
LYWIEQFHLDGLRVDAVSSMLYLDYDIGEWTPNEDGSNHNKAGVEFIQKLNKKVFERHPY
TLMIAEESTAWSKVTKPVHMGGLGFNYKWNMGWMNDTLKFFEMDPLSRKHHFNLITFSFM
YAFNENFILPFSHDEVVHGKKSLMHKMPGDRYNQFASLRTLEAYMMVHPGKKLNFMGNDY
GQFLEWRIHEGLEWQSVNDEMNAKHLHFMESLNLLYKKERALWEVDHQADGIQILDADNA
SETLLTFIRKGKKPRDFVVVICNFVPVERKGYKVGVPYEGIYEECLNTELSEYGGVWTKN
QGPLKTVKETTNQQVHTIELIVPAMSVLILRPKRIFGVPKN
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
gtgacacatctatcaatgagtgaagaagtaaaaaaaaaacttgaagaagaattgttttta
tttaataccggggaatatttcgacagttatttaacgctaggatgcaatagggatacctat
gaagggaactcaggatttcgttttactgtttgggctcctaatgcgataagtatggctgta
gtaggagatttttccgattgggatttaggaatcgaaatggagaaaattggcaaaacgggt
tgttggacagcctttagcgacaaagctatagaaggacaatgttataaataccgtatagaa
caacctgatggaacggtaaagttgaaaattgatccttatgcatttgaatttgaagtaaga
ccaaaagacgcttcgattgtaaagggtttacccgaaaagaaatggaaagatgggttatgg
tctgcaaataaaaaacgattttctatctatgaacgcccactaaacatctatgaagtacat
cttagttcttggaaacaccacgatgatggatcgtggtatacaattcctgaattaaaaaac
gaattgattccttatgttaaaaaaatggggtacacacatattgaattcatgcctttaatg
gaacatcctctagacgcttcttgggggtatcagttgaccggatactatgcgttatcttct
aaatttggcacgatggaagagtttcaagacttagtagaagcggcacacctagcaaatatt
ggagtaatcatggattgggtaccaggccactttaatcgaaatgattatgggatggttcat
tttgatgggacccctcaatttgaatacacagataaaaataaagctcaaaataatcgatgg
ggaacaatgaactttgatttagggaaagctcaagtccaaagcttcttgacttctaatgca
ctatattggatcgaacaatttcatttagatgggttaagagtcgatgccgtatccagtatg
ttgtaccttgattacgatattggtgagtggacgcctaatgaagatggaagcaatcacaat
aaagcaggtgttgaatttattcaaaaacttaataaaaaagtatttgaacgacatccttac
accttgatgatcgccgaagaaagtacggcgtggtcaaaagttacgaaaccagttcatatg
ggagggctaggtttcaactataagtggaatatggggtggatgaatgacacattgaaattt
tttgaaatggatccattatcccgtaaacatcatttcaatttaattactttttcttttatg
tatgcattcaatgaaaactttattttgccattctcgcatgatgaagtggtacatggaaaa
aaatcattgatgcataaaatgccaggtgatcgctacaaccaatttgccagcttgcgtaca
ttagaagcttatatgatggttcacccaggtaaaaagctgaacttcatggggaatgattat
ggtcaatttctagaatggcgcatacatgaaggattggaatggcaaagtgtgaatgacgaa
atgaatgctaaacatttgcactttatggaatcgttaaatttactgtataaaaaagaaaga
gctttatgggaagtagatcatcaagcagatggaatccaaattttagatgcagataatgct
tctgaaactcttttaacgtttattcgaaaaggtaaaaagccgcgtgatttcgtagtcgtt
atttgtaattttgtaccagttgagcgaaaggggtataaggtaggagttccttatgaaggc
atttatgaagagtgtttaaatactgaattgagcgaatatggcggggtctggacaaaaaat
caaggacctttaaaaacggttaaagaaaccactaaccagcaggtccatacgattgaattg
attgtaccggcaatgagcgttttaattttacgaccaaaaagaatttttggagttccaaaa
aattaa

DBGET integrated database retrieval system