KEGG   Corynebacterium atypicum: CATYP_00385Help
Entry
CATYP_00385       CDS       T03227                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cax  Corynebacterium atypicum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cax00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CATYP_00385
   00630 Glyoxylate and dicarboxylate metabolism
    CATYP_00385
   00640 Propanoate metabolism
    CATYP_00385
   00650 Butanoate metabolism
    CATYP_00385
  Lipid metabolism
   00071 Fatty acid degradation
    CATYP_00385
   00072 Synthesis and degradation of ketone bodies
    CATYP_00385
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CATYP_00385
   00310 Lysine degradation
    CATYP_00385
   00380 Tryptophan metabolism
    CATYP_00385
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CATYP_00385
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CATYP_00385
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CATYP_00385
Enzymes [BR:cax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CATYP_00385
Exosome [BR:cax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CATYP_00385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
87106..88377
Genome map
AA seq 423 aa AA seqDB search
MLGGNRIPFARSNKEYADASNRDMLTAAIDGLVARYGLQDERLGMVAAGAVLKHVRDFNL
TRECVLGSSLASTTPAIDVQQACGTGLAAAVYVSDAIARGRIDVGLAGGVDTTSDAPLAV
GDQLRRTLIKLTRAKSASQRAKLIGSIRPAQFVPEQPQNGEPRTGLSMGEHAAITAREFG
ITRQERDELAARSHQNLARAYGEGFFSDLITPFLGVQRDTNLRPDSTVEKLAALRPVFGK
KDAELHGAQATMTAGNSTPLTDGASVALLASEKWAEEHRLPVRAWLVDTETAAVDFVHGP
DGLLMAPTYAIPRLLDRNGLTLQDFDFYEIHEAFASQVLAALAAFESAEYCRDRLGLTEA
LGAIDRERLNVKGSSLAAGHPFAATGARILATAAKMLEEAGGGRTLVSICAAGGQGIAAI
VER
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atcctgggcggcaaccggatcccgtttgcccggtcgaataaggagtacgcggatgcctcg
aaccgggacatgctcaccgcggccatcgacgggctggtcgcccgctacggcctgcaggac
gagcggctgggcatggtcgccgccggcgccgtgctcaagcacgtgcgggactttaacctc
acccgcgagtgtgtgctcggcagctcattagcgtcgacgactccggcgatcgacgtgcaa
caggcttgcggcactgggctggccgcggcggtgtatgtcagcgacgcgatcgcccggggt
cgcatcgatgttgggctcgcaggcggggtggatacgacgtcggacgcgcccctggccgtt
ggcgatcagctgcgccgcacgctgattaagctaacccgggccaagtccgccagccagcgt
gccaagctgattggctcgatcaggccagcccagttcgtgcccgagcagccacagaatggc
gagccgcgcaccgggttgtcgatgggggagcatgcggcgattaccgcgcgggagtttggc
atcacccgccaggagcgggatgagctagccgcgcgttcgcatcagaacctggcccgagcg
tacggggaaggcttttttagcgatctgatcacgccgtttttgggcgtgcagcgcgatacc
aatctgcgtccggattccaccgtggagaagttggcggcgctgcgtccggtatttggtaag
aaggacgctgagctgcacggagcgcaggccacgatgacggccgggaattcgacgccgctt
actgacggcgcgtcggtggcgctgttggcttcggaaaagtgggccgaggagcatcgtctg
ccggtgcgtgcgtggctggttgacaccgagacggcggccgtggactttgtgcatggtccc
gacgggttgctcatggcgcctacctacgcgatcccgcggttgttggatcgcaacgggctt
acgctgcaggacttcgacttctatgagattcacgaggcctttgcctctcaggtgctggcc
gctctcgcggcgtttgagtctgcggagtattgccgggatcggttgggcctaacggaggcg
ttgggtgctatcgatcgcgagcgcctgaatgtcaagggttcctcgttggcggctgggcac
ccgttcgccgcgacgggtgcccgcatcctggctaccgcggcgaagatgctggaagaggcc
ggtggtggtcgcactttggtgagtatttgcgcggccggcgggcagggcatcgcggccatt
gtggagcggtag

DBGET integrated database retrieval system