KEGG   Clostridium acetobutylicum EA 2018: CEA_G0099Help
Entry
CEA_G0099         CDS       T01864                                 

Gene name
hemD
Definition
Uroporphyrinogen III syntase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEA_G0099 (hemD)
Enzymes [BR:cay01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CEA_G0099 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CEA_G0099 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
106556..108028
Genome map
AA seq 490 aa AA seqDB search
MKRSGKVYIIGAGPGEEELITLKAIRKMKECTAVLYDRLVGQGILKYLNEKCEIYYCGKE
PGCHYKTQDEINEMIIKLAKEGHIVGRIKGGDPYIFGRGGEEGLSLLKENIEFEVISGVT
SPVAVLNYAGIPVTHRGIARSFHVFTAKTANDDSINFSAAAKIDGTLIFLMGYRQLNDIT
RKLIENGMDSKMPCAVVMRGTTSLQKKVIGNLSDIKEKCDNANMTSPCIIVVGKVVGFNQ
QLNWYEKKPLFGRNICITRSKNQSKTMREELLDLGAEVTEVHSIEIENTASNLEEYINKI
SEYDYIILTSVNAVEVLFDYLASKDYDVRKVRAKFAVIGNATKEALKKRGIVPEIVSRKH
NGEGLFDEIRGYLKKDDKIFIPRSENSRKYIKEQLVSLGLSVDECFIYRTVPGKLYDKAA
FENADTIVFTSPSTVKNMIALFGEKNIKKKSIIAIGPITGRELGKINAEYSTCSECSVDA
IIRECLNSDK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagatctggtaaggtttatataataggagcaggacctggagaggaagagcttata
accttaaaggcaataagaaaaatgaaagaatgcacagctgtgctttatgatagacttgta
ggacagggaatacttaaatatttgaatgaaaagtgtgagatttattattgtggaaaagag
cctgggtgtcattataaaacccaagatgagataaatgaaatgataataaagctagctaaa
gaaggacatattgttggtagaataaaaggaggagacccatatatttttggaagaggaggg
gaagagggactaagtcttttaaaagagaatatagaatttgaagtgatttcaggggttact
tctcccgtagctgttttaaattatgctggaattcctgtaacgcacaggggcatagcaaga
agctttcatgtatttacggcaaaaacagccaatgacgattctataaattttagtgcagcg
gctaaaattgatgggacactgatatttttaatgggatataggcagcttaacgatataact
agaaagctaatagaaaatggaatggattcaaaaatgccctgcgctgttgtaatgagggga
actactagtcttcagaaaaaggttataggaaatcttagtgatataaaagaaaaatgtgat
aatgctaatatgacttcaccttgtataatagtagtaggaaaagttgttggtttcaatcag
cagctaaattggtatgagaaaaagcctctttttggcagaaatatatgtataacaagatct
aaaaatcaaagcaaaactatgagagaagagcttcttgaccttggagcagaagtaacagaa
gtacattctatagaaatagaaaatacagcctcaaatttagaagaatacattaataaaatt
tcagagtatgattatataatcttgaccagtgtaaatgctgtggaggtcttatttgattat
cttgcttcaaaggattatgatgtaagaaaagtaagggccaagtttgcagttataggaaat
gctacaaaagaagcgctaaagaaaagaggaattgttccagagatagtatctagaaaacac
aatggagaaggtctttttgatgagattagaggctatttaaagaaggatgataagatattt
atccccaggagtgaaaattctagaaagtatataaaggaacaacttgtaagcttagggtta
agtgttgacgagtgttttatatacagaacagttcctggaaagctttatgataaggctgct
tttgaaaatgctgatacaattgtttttacaagtccatcaacggtaaaaaatatgatagct
ctttttggagaaaagaacataaagaaaaagagtataatcgccataggacctataacagga
agagagcttggaaaaataaatgcagaatattctacatgcagtgaatgcagtgtagatgca
ataattagggagtgtttgaacagtgacaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system