KEGG   Clostridium acetobutylicum EA 2018: CEA_G0101Help
Entry
CEA_G0101         CDS       T01864                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CEA_G0101 (hemB)
Enzymes [BR:cay01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CEA_G0101 (hemB)
Exosome [BR:cay04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CEA_G0101 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
109304..110266
Genome map
AA seq 320 aa AA seqDB search
MFRRHRRLRKNSYIRDMVRETTLSPNDFIYPLFVVEGINIKKEIPSLPNNYHYSLDRLPE
VISEINDAGVKGIILFGIPDYKDEIGSSAFDENGIIQKAIRKIREIDKDLFIITDVCMCE
YTSHGHCGIIHDGYVDNDETLKYIGKIALSHAKAGADMIAPSDMMDGRIEEIRTTLDENG
YKNVSIMAYSAKYCSAFYGPFRDAADSAPKFGDRKSYQMDPANAREAMLEIEDDIEEGAD
VIMVKPALAYLDILRTAKNRFDVPVAAYSVSGEYSMIKAGAKMGWIDEKAIALESLLSIK
RAGADMIITYYALEASKWLK
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaagacatagaagattaagaaagaatagctatataagggatatggtaagagag
actacattaagccctaatgactttatttatccgctttttgtggtagaagggataaatata
aaaaaggaaataccatcactgcctaataattatcattattctttagacaggctaccagag
gttatttctgaaattaatgatgcaggtgttaaaggtataattttatttggaataccagat
tataaggatgaaattggttcttctgcttttgatgagaatggaataattcaaaaggcaata
agaaaaataagagaaattgataaagatctatttataataacagatgtatgtatgtgtgaa
tatacaagccatggacattgcggaattattcatgatggatatgttgataatgatgaaact
ctaaaatatataggaaaaatcgcactctctcatgcaaaggcgggagctgacatgattgca
ccgtcagacatgatggatggtagaattgaagaaattaggactactcttgatgaaaacgga
tataagaatgtatctataatggcatatagtgctaaatattgttctgcgttctatggtccg
ttcagagatgctgcggattctgcacctaaatttggagatagaaagagctatcaaatggac
cctgcaaatgcaagagaggctatgcttgagattgaagatgatattgaagaaggcgctgat
gtaataatggtcaagcctgcactagcgtaccttgatatattaagaactgctaaaaataga
tttgatgttccagttgctgcatacagcgttagtggtgaatattcaatgataaaggctgga
gccaaaatgggctggatagatgaaaaggctatagcacttgaatctttattatcaattaaa
agagctggtgctgatatgattataacttattacgcattggaagcttcaaagtggttaaag
tag

DBGET integrated database retrieval system