KEGG   Clostridium acetobutylicum EA 2018: CEA_G0128Help
Entry
CEA_G0128         CDS       T01864                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cay00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CEA_G0128 (recR)
DNA repair and recombination proteins [BR:cay03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CEA_G0128 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
138574..139170
Genome map
AA seq 198 aa AA seqDB search
MEFYPVAIEKLIEEFAKLPGVGYKTAQRLTMHVLNLPKEEVEGFADALKKARGTIKYCSV
CGNYTDTDPCAICSNPNRDKSLVCVVEEPKDIISMEKVREFNGVYHVLHGVISPMLGKGP
DSIKLRELVSRMNGKVKEVIVATNPNVDGEATAMYISKILKPLGVKVTRIAHGIPVGGDL
EYADEVTLAKALEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggaattctatcctgtggcaattgagaaattaatagaagaatttgcaaaactgccaggt
gtcggatataaaacagcacaaaggcttacaatgcatgttttaaatctaccaaaggaagag
gttgaaggttttgcagatgcactaaaaaaggcaagaggaactataaaatactgttctgtt
tgtggtaattatacagatactgatccgtgtgcaatttgttctaatcctaacagagataag
agtcttgtttgtgttgttgaagagccaaaggatataatatctatggaaaaggtaagagaa
ttcaatggtgtttaccatgttcttcatggagtaatatctccaatgcttggaaaaggtcca
gattctataaaacttagagaacttgttagtaggatgaatggaaaagttaaggaagttatt
gttgcaaccaatcctaatgtagatggagaggctacagctatgtatatatcaaaaatctta
aaaccgcttggagttaaagttactagaatagctcatggtattccggttggaggagacctt
gagtatgcagatgaggtgactctagctaaagcgcttgaaggaagaagagaaatatag

DBGET integrated database retrieval system