KEGG   Clostridium acetobutylicum EA 2018: CEA_G0187Help
Entry
CEA_G0187         CDS       T01864                                 

Definition
Beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CEA_G0187
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CEA_G0187
Enzymes [BR:cay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CEA_G0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206065..207621
Genome map
AA seq 518 aa AA seqDB search
MIDVKKLPLDIKIGQMIMAGFTSKHYDSSLEKLITDDKIGNFILFSRNIEEKNQLTRLTE
DIQKGLEINIKIPGIISVDQEGGMVTRINSGTTIFPGNMAFAAANHPHSTFRQGKIEGEE
LRGLGVNMNLAPVMDVNCNPSNPVIGVRSYSDSPEKVAELGLELIKGLKESKVVPVAKHF
PGHGDTDVDSHLSLPVVKHSIKRLRKVELLPFKTAIENGIDAIMSAHVLFPEIEPKRLPA
TLSYRVLTDLLRNKMGFKGIIITDCMEMKAIAEFYGSDKAAVMAIKAGADLICISHSAAV
QKACIRRIKEAVINKEISEERINESVKRILEIKEKYSISFNTVKRNYDINNSLFAEEISD
KSITLLKNDKSLIPLKGRIVSISTKAVALTGAEDNMSLNNSFCHKLKENFGGSEFQIPIN
PHKEIIDKILEKCLDADSIVIGIYNAYNHEGQRKLVNEISKVNPNIVLVSLRNPYDFLYF
KEVSAYINAYEYTNLSVKSVIKVLSGRVEAQGISPVRL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtaaaaaagcttcctcttgatataaaaataggacaaatgataatggcaggg
tttacttcaaagcattacgattcttctttggaaaaactgattacagatgataagatagga
aatttcatattgttttcgagaaatatagaagagaaaaatcagctcacaaggcttacagag
gatattcaaaaaggactagaaatcaatattaaaattccaggaattatttctgttgatcaa
gaaggtggaatggttacaagaataaattcagggactacaatatttcctggaaatatggct
tttgcagcagcaaatcatccacatagcacttttagacagggaaaaattgagggagaagag
cttagaggtttgggtgtaaatatgaatctagcaccagttatggatgtgaactgtaatccc
agtaacccagttataggagttaggtcttatagtgatagtcctgaaaaagtagcagaactg
ggtttggaattaataaaaggtttaaaagaaagtaaggtagttccagttgcaaagcatttc
ccgggacatggagatacggatgtggattctcaccttagtttgcctgtagtaaagcattct
attaaaaggcttcgtaaagtcgagcttcttccatttaagactgcaatagaaaatggaatt
gatgcaataatgtcagcacatgtgctctttccagaaatagaacccaaaaggcttcctgct
acactttcatatagggttcttacagatttattaagaaataaaatgggttttaagggcatt
ataataacagattgcatggagatgaaggctatagcagagttctatggcagtgataaggca
gcagttatggcaattaaagcaggagcagatttaatttgtatatcccatagtgcggcggta
cagaaagcttgtatacgtagaattaaagaagcagtaataaataaagaaatctctgaagag
agaataaatgaatcagtaaaaagaattctagaaataaaagagaaatatagcatttcattt
aatacagtcaaaagaaactatgatataaataatagtcttttcgcagaagaaataagtgat
aaaagcataacacttctaaagaacgataaaagtttaatcccacttaaaggaaggattgta
tccatatctacaaaagcagtagcacttactggggctgaagataatatgagcctaaacaat
tctttttgtcataaattaaaagagaactttggtggcagtgaatttcaaataccaattaat
ccccataaagaaataatagataaaatattagaaaaatgcctagatgcagatagtatagta
ataggtatttataatgcatacaatcatgaaggtcaaagaaaacttgtgaatgaaataagt
aaggttaatcctaatatagtactggtatccttaaggaatccctatgattttttatatttt
aaggaagtttcagcttatataaatgcctatgaatacactaatttgtcagtaaaaagtgta
attaaagtattatcgggaagagtagaggctcaagggatttcaccagttagactttag

DBGET integrated database retrieval system