KEGG   Clostridium acetobutylicum EA 2018: CEA_G0187Help
Entry
CEA_G0187         CDS       T01864                                 

Definition
Beta-glucosidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cay00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cay00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206065..207621
Genome map
AA seq 518 aa AA seqDB search
MIDVKKLPLDIKIGQMIMAGFTSKHYDSSLEKLITDDKIGNFILFSRNIEEKNQLTRLTE
DIQKGLEINIKIPGIISVDQEGGMVTRINSGTTIFPGNMAFAAANHPHSTFRQGKIEGEE
LRGLGVNMNLAPVMDVNCNPSNPVIGVRSYSDSPEKVAELGLELIKGLKESKVVPVAKHF
PGHGDTDVDSHLSLPVVKHSIKRLRKVELLPFKTAIENGIDAIMSAHVLFPEIEPKRLPA
TLSYRVLTDLLRNKMGFKGIIITDCMEMKAIAEFYGSDKAAVMAIKAGADLICISHSAAV
QKACIRRIKEAVINKEISEERINESVKRILEIKEKYSISFNTVKRNYDINNSLFAEEISD
KSITLLKNDKSLIPLKGRIVSISTKAVALTGAEDNMSLNNSFCHKLKENFGGSEFQIPIN
PHKEIIDKILEKCLDADSIVIGIYNAYNHEGQRKLVNEISKVNPNIVLVSLRNPYDFLYF
KEVSAYINAYEYTNLSVKSVIKVLSGRVEAQGISPVRL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgtaaaaaagcttcctcttgatataaaaataggacaaatgataatggcaggg
tttacttcaaagcattacgattcttctttggaaaaactgattacagatgataagatagga
aatttcatattgttttcgagaaatatagaagagaaaaatcagctcacaaggcttacagag
gatattcaaaaaggactagaaatcaatattaaaattccaggaattatttctgttgatcaa
gaaggtggaatggttacaagaataaattcagggactacaatatttcctggaaatatggct
tttgcagcagcaaatcatccacatagcacttttagacagggaaaaattgagggagaagag
cttagaggtttgggtgtaaatatgaatctagcaccagttatggatgtgaactgtaatccc
agtaacccagttataggagttaggtcttatagtgatagtcctgaaaaagtagcagaactg
ggtttggaattaataaaaggtttaaaagaaagtaaggtagttccagttgcaaagcatttc
ccgggacatggagatacggatgtggattctcaccttagtttgcctgtagtaaagcattct
attaaaaggcttcgtaaagtcgagcttcttccatttaagactgcaatagaaaatggaatt
gatgcaataatgtcagcacatgtgctctttccagaaatagaacccaaaaggcttcctgct
acactttcatatagggttcttacagatttattaagaaataaaatgggttttaagggcatt
ataataacagattgcatggagatgaaggctatagcagagttctatggcagtgataaggca
gcagttatggcaattaaagcaggagcagatttaatttgtatatcccatagtgcggcggta
cagaaagcttgtatacgtagaattaaagaagcagtaataaataaagaaatctctgaagag
agaataaatgaatcagtaaaaagaattctagaaataaaagagaaatatagcatttcattt
aatacagtcaaaagaaactatgatataaataatagtcttttcgcagaagaaataagtgat
aaaagcataacacttctaaagaacgataaaagtttaatcccacttaaaggaaggattgta
tccatatctacaaaagcagtagcacttactggggctgaagataatatgagcctaaacaat
tctttttgtcataaattaaaagagaactttggtggcagtgaatttcaaataccaattaat
ccccataaagaaataatagataaaatattagaaaaatgcctagatgcagatagtatagta
ataggtatttataatgcatacaatcatgaaggtcaaagaaaacttgtgaatgaaataagt
aaggttaatcctaatatagtactggtatccttaaggaatccctatgattttttatatttt
aaggaagtttcagcttatataaatgcctatgaatacactaatttgtcagtaaaaagtgta
attaaagtattatcgggaagagtagaggctcaagggatttcaccagttagactttag

DBGET integrated database retrieval system