KEGG   Clostridium acetobutylicum EA 2018: CEA_G0219Help
Entry
CEA_G0219         CDS       T01864                                 

Definition
(GenBank) Endoglucanase, aminopeptidase M42 family
Organism
cay  Clostridium acetobutylicum EA 2018
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
238696..239736
Genome map
AA seq 346 aa AA seqDB search
MDTKLLLRELCLKDAPSGAEKELYDVVNREFSEFGNVEIDELNNIYINKRGKGAGKIALM
AHGDEIFLMISGFEKNGFLKFKAVGIDPKVLISQEVKIHGKREVLGIIGVKPPHLMNDKE
KEAAIPTSELLIDTGFSTDKLKEIVNIGDYVTIKRDFYELLNNNVACKAMDNRASITAMY
VCARELNKIDHNADVVFICSCQEEVGHRGAKMSAYKTKPDICIAVDVTFDGGKLGDPDRE
NEVGGGPVICIGPNIHAKVRKKVIGIANKYNIPYKVEVEPGNTGCDAWDTQISRDGIPSL
LISVPEKYMHTSVEMVNIEDIENTGKLIAKFIEELNNIEMEELLCF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
ttggacactaaattattattaagagaattatgtttgaaggatgcaccaagtggagctgaa
aaagaactttatgacgttgtaaatcgagaattttcggaatttggaaatgtagaaatcgat
gaactaaataatatatacataaataaacgtggaaagggagctggcaaaattgcacttatg
gctcacggagatgagatttttcttatgataagtggttttgaaaaaaatggcttcttaaaa
tttaaagcagtaggaatagatcctaaagtattgatttctcaggaagttaaaattcacgga
aaaagagaagtacttggaattataggtgtaaagccaccgcatttaatgaatgataaggaa
aaggaagctgcaattcccacaagtgagcttttaatagatacaggttttagtactgataag
ttaaaggaaatcgtaaacataggagattatgtaacgattaaaagggatttttatgaactt
ttaaataataatgtggcttgtaaggcaatggataatagagctagcataacagcaatgtat
gtgtgtgcaagagaattgaataaaatagatcacaatgctgatgtggttttcatatgctca
tgccaagaagaggttggacacagaggagctaaaatgtcagcgtataagactaagcctgat
atatgtatagcagtggatgttacctttgacggaggaaaacttggagatccagatagagaa
aatgaagtaggaggaggtccggttatatgtataggtcctaatatacacgcaaaggttaga
aaaaaagtaattgggattgcaaacaagtataatattccttataaagttgaagttgaacct
ggaaacacaggttgtgatgcatgggacactcagatatctagagatgggattccatcgctt
ttaatatctgtgcctgaaaaatatatgcatacctctgttgagatggttaatatagaagac
atagaaaatacaggtaagcttatagctaaatttattgaagagctaaataacattgaaatg
gaggaacttttatgcttttag

DBGET integrated database retrieval system