KEGG   Clostridium acetobutylicum EA 2018: CEA_G0395Help
Entry
CEA_G0395         CDS       T01864                                 

Definition
Beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cay  Clostridium acetobutylicum EA 2018
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cay00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEA_G0395
Enzymes [BR:cay01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CEA_G0395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
448315..449724
Genome map
AA seq 469 aa AA seqDB search
MKFPKDFFLGAASASYQVEGAWNEDGKGVSNWDVFTKIPGKTFEGTNGDVAVDHYHRYKE
DVKLMAEMGLDSYRFSVSWPRIIPDGDGEINQKGIEFYNNLIDECLKYGIVPFVTLYHWD
MPEVLEKAGGWTNKKTVDAFVKYAKACFEAFGDRVKRWITFNETIVFCSNGYLSGAHPPG
ITGDVKKYFQATHNVFTAHARSVIEYKKLKQYGEIGITHVFSPAFSVDDKEENKAAAYHA
NQYEITWYYDPILKGKYPEYVIKNIEKQGFLPDWTDEELNTLREAAPLNDFIGLNYYQPQ
RVIKNHDTGEKIERTRENSTGAPGNASFDGFYRTVKMDDKTYTKWGWEISPESLILGLEK
LKEQYGDIKIYITENGLGDQDPIIEDEILDMPRIKFIEAHLRAIKEAISRGINLKGYYAW
SVIDLLSWLNGYKKQYGFIYVDHKHNLDRKKKLSFYWYKKVIEERGKNI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttccaaaggatttctttttaggtgctgcttctgcatcataccaggtagagggt
gcctggaatgaagatggaaagggagtatctaactgggatgtatttaccaaaataccagga
aaaacttttgaaggtactaatggagatgttgcagtagaccactaccatagatacaaagaa
gacgtaaaactgatggcagaaatgggacttgattcatacagattctccgtttcttggcca
agaataataccagatggtgatggagaaataaatcaaaagggaatagagttttacaataat
ttgatcgatgagtgccttaaatatggcattgtaccatttgttaccttgtatcactgggat
atgccagaggtactggagaaggctggaggatggacaaataaaaaaactgtagatgccttt
gtaaagtatgctaaagcgtgttttgaagcgtttggagatagggtaaagcgctggattact
tttaatgagactatagtgttttgcagcaatggatacttaagtggagctcacccgcctggt
ataacaggagatgttaaaaagtattttcaagcaacacacaatgtatttacagctcatgcc
agatcagttattgaatataaaaaattaaaacagtatggcgaaataggaataacgcatgta
ttctcaccagccttcagtgttgatgataaggaagaaaataaggctgctgcatatcatgca
aatcaatatgagattacctggtattacgatccaatattaaagggaaaataccccgaatat
gtaattaaaaatatagaaaaacaaggatttttaccagattggacagatgaggaattgaat
acattaagggaggcagctccgcttaatgactttataggacttaactactatcaacctcaa
agagtaattaaaaatcatgacacaggggaaaaaattgaaagaacaagggagaactctaca
ggggcacctggaaatgcatcctttgatggattttatagaacagtaaaaatggacgacaaa
acttacactaaatggggctgggagatatcacctgaatcattaattttggggcttgagaaa
ttgaaagaacagtatggtgatatcaaaatttatattactgaaaacggtttaggcgatcag
gatccaataatagaagatgaaattcttgatatgcctagaataaaattcatagaagctcat
ttaagagcaataaaagaagctataagtagggggataaaccttaaaggatattacgcttgg
tcagtaatcgatcttttaagttggcttaacggatacaaaaaacagtatggttttatatat
gtagaccataaacacaatttagatagaaagaagaaattatcattttattggtataaaaaa
gtaatagaagaaagaggtaaaaatatatag

DBGET integrated database retrieval system